PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN26407.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YC
Protein Properties Length: 292aa    MW: 32349.9 Da    PI: 5.1682
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN26407.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC61.71.5e-196861898
       NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                ++++P arikki++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +t++   ++ +v++  +fdfl div r
  KHN26407.1  6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYEVTLQRGAKTMNSLHLKHCVQSYSVFDFLRDIVSR 86
                5789**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.5E-26372IPR009072Histone-fold
SuperFamilySSF471131.31E-20490IPR009072Histone-fold
PfamPF008084.1E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDRT YEVTLQRGAK  60
TMNSLHLKHC VQSYSVFDFL RDIVSRVPDY GHGHGHGHSE AGADDRALPK RRKAVGDDGN  120
DSDEEAKRSK MRELGHTGTP GRGRGRGRGR GRGRGARTIE RDICHQQVES EPCTSILQSS  180
NDIPNTSVPI DNGPQSKELP KENFVISEES TQSFRNIDLN ANLNENEDKN AGTAVPASLP  240
EPTSMDTAME IKHEEIPGWS LSDVDKMGID TMQLANLGSR LEEDEEDYDE EG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A3e-23272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143153RGRGRGRGRGR
2145154RGRGRGRGRG
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN26407.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1984470.0AC198447.7 Glycine max cultivar Williams 82 clone gmw2-48a19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527524.10.0dr1-associated corepressor homolog
RefseqXP_028238342.10.0dr1-associated corepressor homolog
TrEMBLA0A0B2R3F10.0A0A0B2R3F1_GLYSO; Dr1-associated corepressor
TrEMBLI1KFK30.0I1KFK3_SOYBN; Uncharacterized protein
STRINGGLYMA06G46850.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17283491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.13e-71nuclear factor Y, subunit C11
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]