PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN25779.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 50aa    MW: 5853.56 Da    PI: 4.4743
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN25779.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.11.5e-11242345
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                      ++++E+ l+++  k+ G + W++Ia +++ gRt++++  +w 
       KHN25779.1  2 EFSEDEETLIIRMYKLVGER-WSLIAGRIP-GRTAEEIEKYWT 42
                     59******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.36149IPR017930Myb domain
SMARTSM007179.9E-6147IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-14243IPR009057Homeodomain-like
CDDcd001676.44E-8241No hitNo description
PfamPF002491.7E-10242IPR001005SANT/Myb domain
SuperFamilySSF466896.16E-10345IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 50 aa     Download sequence    Send to blast
VEFSEDEETL IIRMYKLVGE RWSLIAGRIP GRTAEEIEKY WTSRFSGSSE
Functional Description ? help Back to Top
Source Description
UniProtMYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN25779.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2381142e-58KP238114.1 Lablab purpureus caprice and triptychon-like enhancer transcript variant X1 (etcl1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592819.11e-28MYB-like transcription factor ETC1
RefseqXP_028193891.11e-28MYB-like transcription factor ETC1
SwissprotQ9LNI53e-17ETC1_ARATH; MYB-like transcription factor ETC1
TrEMBLA0A445HSS62e-27A0A445HSS6_GLYSO; MYB-like transcription factor ETC1
TrEMBLK7LVX52e-27K7LVX5_SOYBN; Uncharacterized protein
STRINGGLYMA12G32130.34e-28(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01380.11e-19MYB_related family protein
Publications ? help Back to Top
  1. Savage N, et al.
    Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana.
    PLoS ONE, 2013. 8(10): p. e75452
    [PMID:24130712]
  2. Wada T,Hayashi N,Tominaga-Wada R
    Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis.
    Plant Signal Behav, 2015. 10(11): p. e1089372
    [PMID:26339713]
  3. Huang M,Hu Y,Liu X,Li Y,Hou X
    Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development.
    Front Plant Sci, 2015. 6: p. 955
    [PMID:26579186]
  4. Wada T,Tominaga-Wada R
    CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression.
    Plant Sci., 2015. 241: p. 260-5
    [PMID:26706076]
  5. Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R
    The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells.
    Plant J., 2016. 88(5): p. 762-774
    [PMID:27496682]
  6. Tominaga-Wada R,Kurata T,Wada T
    Localization of ENHANCER OF TRY AND CPC1 protein in Arabidopsis root epidermis.
    J. Plant Physiol., 2017. 214: p. 48-52
    [PMID:28437677]
  7. Tominaga-Wada R,Kurata T,Wada T
    Localization of the CAPRICE-ENHANCER OF TRY AND CPC1 chimera protein in Arabidopsis root epidermis.
    Biosci. Biotechnol. Biochem., 2017. 81(9): p. 1762-1767
    [PMID:28644769]
  8. Tominaga-Wada R,Wada T
    Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation.
    Development, 2017. 144(13): p. 2375-2380
    [PMID:28676568]
  9. Tominaga-Wada R,Wada T
    Effect of amino acid substitution of CAPRICE on cell-to-cell movement ability in Arabidopsis root epidermis.
    Dev. Biol., 2018. 435(1): p. 1-5
    [PMID:29337129]