PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN25617.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 400aa    MW: 44478.8 Da    PI: 4.3599
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN25617.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.49.2e-10247291146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+W+++E el+++av+++G++ ++ I + +  ++++ q+k+++ +
       KHN25617.1 247 RGKWSKQETELFYEAVREMGTD-FSMIQEIFFPNKSRHQIKLKYKN 291
                      89********************.*****98877***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.6E-23240311No hitNo description
PROSITE profilePS500906.481242293IPR017877Myb-like domain
SMARTSM007172.7E-9246295IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-8247291IPR009057Homeodomain-like
SuperFamilySSF466891.72E-11248297IPR009057Homeodomain-like
CDDcd001672.79E-7249291No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MDPFDDILPV APTARTRPGA KFIPKAKSKQ LPRKEIPVSE HATSSKDGIL GNECQNAVAS  60
AEESKGFIHH TQVEIPNSGD STNSKQASVK GDTAALVDDS TITASEVDAN QNSINFLKPA  120
CEVTEKCFLF PVDKALLEIP EDELDRLRIP IKDIILLEEH RERLAKKEAM TSNISSTNQS  180
GGDSLHEAGA YNEGAYNEGA YDDGAYNDGE FLGSEDGRDP YDDQANEGIA STSVLLNYQS  240
FREKTPRGKW SKQETELFYE AVREMGTDFS MIQEIFFPNK SRHQIKLKYK NEERQQPLQL  300
TDAVNNRAKD HPHSKLFIER LQLASAKAED PCRDASDFVM AEEVVDLTAG TNEEVAEVAT  360
TKEDADVKEQ EDSVAVPSPE QSDDSEDDFQ RWSQYKSGYQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN25617.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0914152e-38BT091415.1 Soybean clone JCVI-FLGm-7N10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003516729.10.0uncharacterized protein LOC100792788 isoform X1
RefseqXP_028248487.10.0uncharacterized protein LOC114425731 isoform X1
TrEMBLA0A445M7320.0A0A445M732_GLYSO; Uncharacterized protein
TrEMBLA0A445M7D40.0A0A445M7D4_GLYSO; Uncharacterized protein
TrEMBLK7K5C70.0K7K5C7_SOYBN; Uncharacterized protein
STRINGGLYMA01G43821.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36662938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.11e-30MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]