PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN25424.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GATA
Protein Properties Length: 289aa    MW: 31913.6 Da    PI: 5.1245
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN25424.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.77.5e-19210243134
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                 Cs+C++ kTp+WR gp g+ktLCnaCG+++++ +
  KHN25424.1 210 CSHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGR 243
                 *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.1E-811286IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.372204240IPR000679Zinc finger, GATA-type
SMARTSM004012.3E-14204258IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.55E-14206266No hitNo description
Gene3DG3DSA:3.30.50.102.5E-14208241IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.90E-14209266No hitNo description
PROSITE patternPS003440210235IPR000679Zinc finger, GATA-type
PfamPF003201.5E-16210243IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MEVAAAKALK PSLRTEFIFP QAIYDEILCF NANNVVAGED FSVDDLLDFS NGEFQVGKDF  60
DDYEEDEDEE KGSTSGSLQS QDRTEDDSNS NSTAGGGGDS VFAGELSVPA DDVADLEWVS  120
HFVDDSLPEL SLLYPVRCSE QTRVCTEPEP RPGSVQTIPA VPRKPRTGKT RKPNARVWSS  180
MSSLCSSVTA KKQKKKVEAQ NGGAQSLRRC SHCQVQKTPQ WRTGPLGPKT LCNACGVRFK  240
SGRLFPEYRP ACSPTFSDDI HSNSHRKVLE MRRKKEIVES DRIQLIPSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352641e-112AC235264.1 Glycine max strain Williams 82 clone GM_WBb0041H18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003540668.20.0PREDICTED: GATA transcription factor 7-like
SwissprotO655159e-60GATA7_ARATH; GATA transcription factor 7
TrEMBLK7LSW50.0K7LSW5_SOYBN; Uncharacterized protein
STRINGGLYMA12G04180.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.14e-56GATA transcription factor 7