PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN24535.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 477aa    MW: 52818.9 Da    PI: 5.7306
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN24535.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.1e-1656100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+eE++++++a k++G g W+ I +++g ++ + q++s+ qk+
       KHN24535.1  56 REKWTEEEHQKFLEALKLYGRG-WRQIEEHIG-TKNAVQIRSHAQKF 100
                      789*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.07E-1550104IPR009057Homeodomain-like
PROSITE profilePS5129420.55451105IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-953107IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-1554103IPR006447Myb domain, plants
SMARTSM007174.8E-1255103IPR001005SANT/Myb domain
PfamPF002492.0E-135699IPR001005SANT/Myb domain
CDDcd001672.23E-1058101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MEMQDQIEST RSTIFGSASN IHSNGEKQSE NVAHIPSVGN NQTPKVRKPY TITKQREKWT  60
EEEHQKFLEA LKLYGRGWRQ IEEHIGTKNA VQIRSHAQKF FSKVVRESEG SAESSIQPIN  120
IPPPRPKRKP LHPYPRKSVN SFKGHCIPNE TEISPSTNLL VAEKDTPSPT SVLSTVGSEA  180
FGSQFSEQTN RCLSPNSCTT DIHSVSLSPA EKENDCMTSK ASEEEEKASP ASLPLSTVSN  240
PNMCMKPEFS SKDTFIEDAA NMPQTTSIKL FGRTVSMVGN QKSLNIDDDD GKPITVKSDE  300
VDDVENEKLG QSGESKQVDT QLSLGVVSGN WIITPDADGA NTTSIEPPKE NLCFSECAPD  360
ASFPQWSLYQ GLPPFYLRPC NQVLNPLPLR PSLKVRTREE ESCCTGSNTE SVCDMENQGK  420
NSDAVDSKCQ KYHKEGAAPQ KRARGFVPYK RCLSERDGNS LIVDMEEREG QRARVCS
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN24535.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-178AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003548314.10.0protein REVEILLE 7
RefseqXP_014624432.10.0protein REVEILLE 7
RefseqXP_028207255.10.0protein REVEILLE 7-like
RefseqXP_028207256.10.0protein REVEILLE 7-like
TrEMBLA0A445GLJ10.0A0A445GLJ1_GLYSO; Protein REVEILLE 7 isoform A
TrEMBLI1MQL70.0I1MQL7_SOYBN; Uncharacterized protein
STRINGGLYMA16G34340.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73133244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.17e-51MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]