PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN24368.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 367aa    MW: 41149.6 Da    PI: 7.6261
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN24368.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.41e-30244299156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH+rFv+a+e+LGGs+ +tPk+i+elm v+gLt+++vkSHLQkYRl+
  KHN24368.1 244 KQRRCWSPELHSRFVKALEELGGSQATTPKQIRELMRVDGLTNDEVKSHLQKYRLH 299
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.148241301IPR017930Myb domain
SuperFamilySSF466891.88E-16242302IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-28243302IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-24244299IPR006447Myb domain, plants
PfamPF002491.2E-7246297IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MGLVIPEEEL SLDLRPSFVP KTITDFLCHL STTPNASVKV SLLDDFVHRL QLELAKIQAF  60
KRELPLCMFL LNDAISALKV ESEKCMACKS EPVLEEFIPL KKECDQREES EKEKECRDKK  120
SWMSSFQLWN TDDKADINNN AYECDKKQNY GVEDKNNREE RKSVAKDLFQ YGGIRNGEKG  180
FVMPFSTYPA SKEVKEDCVF NGLSLQTPGT AVKNTREGSG CRTSSCRVVS SAPSPLRQPQ  240
SGRKQRRCWS PELHSRFVKA LEELGGSQAT TPKQIRELMR VDGLTNDEVK SHLQKYRLHT  300
QRVPVAKAAN SNRSAVALGG LWMHNESLKG RSSGSPQGPL QLATQSGEAT SRTEGDNMID  360
DDVKSDL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528384.10.0PREDICTED: probable transcription factor KAN3
TrEMBLA0A0B2QX630.0A0A0B2QX63_GLYSO; Two-component response regulator ARR10
TrEMBLI1KL260.0I1KL26_SOYBN; Uncharacterized protein
STRINGGLYMA07G29490.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.18e-52G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]