PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN24174.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 287aa    MW: 31836.5 Da    PI: 7.6395
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN24174.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-1659103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
       KHN24174.1  59 RERWTDEEHKKFLEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 103
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-1753106IPR009057Homeodomain-like
PROSITE profilePS5129421.12154108IPR017930Myb domain
TIGRFAMsTIGR015574.5E-1757106IPR006447Myb domain, plants
SMARTSM007174.7E-1358106IPR001005SANT/Myb domain
PfamPF002497.0E-1459102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-959102IPR009057Homeodomain-like
CDDcd001671.18E-1061104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MAIQDQNGFY RSQGGPPEGG GVSLSSGHSV THIQLNDQFS CGNDYALKVR KPYTITKQRE  60
RWTDEEHKKF LEALKLYGRA WRRIEEHVGT KTAVQIRSHA QKFFSKVLHD PTGNNTNTVE  120
SIEIPPPRPK RKPMHPYPRK LVETPNKEIS IPEQPMKSNS LKSSDFDQEN QSPKSVLSGV  180
GSDSLGSSDS DTPNGSLSPM SSISGFHTSS FTRAKPKTTT SEEEAGMDTD STHDEKPLMK  240
FKLPPNGCVS IKEDNTAEES SGRTFKLFGM TLFVTDTCKP SPTIEEC
Functional Description ? help Back to Top
Source Description
UniProtMorning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN24174.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311990.0KT031199.1 Glycine max clone HN_CCL_153 MYB/HD-like transcription factor (Glyma11g33180.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028197882.10.0protein REVEILLE 1-like
SwissprotF4KGY63e-60RVE1_ARATH; Protein REVEILLE 1
TrEMBLA0A0B2QVU40.0A0A0B2QVU4_GLYSO; Myb-like protein G
STRINGGLYMA11G33180.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29563372
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.11e-47MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  3. Xu G, et al.
    REVEILLE1 promotes NADPH: protochlorophyllide oxidoreductase A expression and seedling greening in Arabidopsis.
    Photosyn. Res., 2015. 126(2-3): p. 331-40
    [PMID:25910753]
  4. Jiang Z,Xu G,Jing Y,Tang W,Lin R
    Phytochrome B and REVEILLE1/2-mediated signalling controls seed dormancy and germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12377
    [PMID:27506149]