PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN23993.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 467aa    MW: 51601.6 Da    PI: 6.7937
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN23993.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.46e-32254309156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  KHN23993.1 254 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 309
                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.355251311IPR017930Myb domain
SuperFamilySSF466895.38E-17251312IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-28252312IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-26254309IPR006447Myb domain, plants
PfamPF002498.2E-7256307IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MPSQAELSMM DYKPYSYSTL LKSFLDQTET DQTYKLEEFL SRLEEERVKI DAFKRELPLC  60
MQLLTNAVEA SRQQLQAFRS NQGTRPVLEE FMPILKHPNS QESAEKTSNI SDKANWMTSA  120
QLWSQASEGT KPQSTITSLP KEGADIGFSV SPKLALDNKH RNGGAFLPFS KERNSCQGLR  180
GLPELALASP EKEIEENKCE LEAEKCSKRE NPGKGGSCEG VNVDQGKSAS VASEAQTANT  240
TTTTTNTSGQ THRKARRCWS PDLHRRFVNA LQMLGGSQVA TPKQIRELMK VDGLTNDEVK  300
SHLQKYRLHT RRPSPSLHTG GPTPQLVVLG GIWVPPEYAT TTAAMTNSGD PTLYGPHPTS  360
QVAPPHYCAA TQMPQEFYNS ALPLSLLPPP HDYTLHHHHF HMYKTAAQTQ NSPESDIRSS  420
GDRSESIVDG KSESGKWNGE SGEKKGLAAL RDQEGEESTG SEITLKF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528276.10.0PREDICTED: uncharacterized protein LOC100809196
TrEMBLA0A0B2QW080.0A0A0B2QW08_GLYSO; Two-component response regulator-like APRR2
TrEMBLK7KWE50.0K7KWE5_SOYBN; Uncharacterized protein
STRINGGLYMA06G23902.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-113G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]