PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN23438.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 600aa    MW: 66808.7 Da    PI: 4.5611
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN23438.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS451.74.8e-1382285973374
        GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                 +lL+ecA a+s+g+  + ++++++l++++s +g+p qR+aay++e+Laarla+s++++ykal+++e +   +s++laa+++++ev+P++kf++++aN++
  KHN23438.1 228 KLLYECAIALSEGNEVEGSSMINNLRQMVSIQGEPSQRIAAYMVEGLAARLAESGKSIYKALRCKEPP---TSDRLAAMQILFEVCPCFKFGFIAANNT 323
                 79*****************************************************************9...9*************************** PP

        GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 I eav+ + ++HiiDfdi+qG Q+++L+q+LasR+++pp++R+Tgv++pes+  s   l+++g+rL+k+Ae+lg+pfef++ va+r++ +++++L+++p
  KHN23438.1 324 ITEAVKDDMKIHIIDFDINQGSQYINLIQTLASRSSKPPHVRLTGVDDPESVqrSVGGLRNIGQRLEKLAEALGLPFEFRA-VASRTSIVTPSMLNCSP 421
                 **************************************************9999999************************.7**************** PP

        GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                 +Eal+Vn+++qlh+++desvs+ +erd++L+lvksl+Pk+v+vveq++++n+++Fl rf+ea +yysa+f+sl+a+lpres++r++vEr++l+r+ivnv
  KHN23438.1 422 DEALVVNFAFQLHHMPDESVSTVNERDQLLRLVKSLNPKLVTVVEQDVNTNTTPFLPRFVEAYNYYSAVFESLDATLPRESQDRMNVERQCLARDIVNV 520
                 *************************************************************************************************** PP

        GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 vaceg++r+er e ++kWr+r+++aGF++ p+s++++++++ l+++v+ d y+++ee g+l +gW+d++L+++SaW+
  KHN23438.1 521 VACEGEDRIERYEVAGKWRARMTMAGFTSSPMSTNVTDEIRKLIKTVYCDRYKIKEEMGALHFGWEDKNLIVASAWK 597
                 ************************************************888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.279200577IPR005202Transcription factor GRAS
PfamPF035141.7E-135228597IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MSLVRSADLA PTSYENAKLF SLKGTDVRPG LSSQIFDPDK HRSMYMTDAY SGEGYEKYFH  60
DSQTEELIEP SSSSISGSSI HPDVASSYQL RASSGASMVA NNPSDSSFMS TRHHDAYQSN  120
SGSDLMENGS LDSRDDEGLM RLRLKALERA LLDDSDAGED EEEEEEEEED IFEAAQSMEI  180
DPDIAEWADS MHNMLLHGSP KESSSSDSNT SSISSTKEIS QTSQTPKKLL YECAIALSEG  240
NEVEGSSMIN NLRQMVSIQG EPSQRIAAYM VEGLAARLAE SGKSIYKALR CKEPPTSDRL  300
AAMQILFEVC PCFKFGFIAA NNTITEAVKD DMKIHIIDFD INQGSQYINL IQTLASRSSK  360
PPHVRLTGVD DPESVQRSVG GLRNIGQRLE KLAEALGLPF EFRAVASRTS IVTPSMLNCS  420
PDEALVVNFA FQLHHMPDES VSTVNERDQL LRLVKSLNPK LVTVVEQDVN TNTTPFLPRF  480
VEAYNYYSAV FESLDATLPR ESQDRMNVER QCLARDIVNV VACEGEDRIE RYEVAGKWRA  540
RMTMAGFTSS PMSTNVTDEI RKLIKTVYCD RYKIKEEMGA LHFGWEDKNL IVASAWKLPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-5424959726375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003526667.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_003526668.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_006581608.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_014631848.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_014631849.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_014631850.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A0B2QUF30.0A0A0B2QUF3_GLYSO; Scarecrow-like protein 1
STRINGGLYMA06G12701.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49883457
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]