PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN23343.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 278aa    MW: 30589.8 Da    PI: 8.6828
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN23343.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.91.2e-391069261
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                k++al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+s
  KHN23343.1 10 KDQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRS 69
                7899******************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30668IPR003851Zinc finger, Dof-type
PfamPF027015.7E-341168IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2641468IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101652IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MLERRARPQK DQALNCPRCN STNTKFCYYN NYSLSQPRYF CKTCRRYWTE GGSLRNVPVG  60
GGSRKNKRST PSAPPPSSAS AQAKKLPDLT TPNFPQSASQ DPKIHQGQDL NLAYPPAEDY  120
NTVSMSKLIE VPYNTELDKG GLHQNPTSSS TPTSASSHHQ LSAMELLKTG IAAASSRGLN  180
SFMPMYNSTH HGFPLQDFKP PHHGLNFSLE GFDNGTYGGL HQGIQEDPTT GGARILFPTV  240
EDLKQQVPST NEFDHQQNRS QEGSAHGYWN GMLGGGSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572720.0DQ857272.1 Glycine max Dof28 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236794.10.0Dof21b
TrEMBLA0A0B2QU840.0A0A0B2QU84_GLYSO; Dof zinc finger protein DOF3.7
STRINGGLYMA04G41170.11e-157(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.43e-54Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]