PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN23155.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 256aa    MW: 29243.2 Da    PI: 9.2781
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN23155.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.55.6e-12127170347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rW++eE+ l++++ +++ +g+W  I+r +  +R + q+ s+ qky
       KHN23155.1 127 RWSEEEHRLFLHGLQKYRMGDWINISRIIK-TRNPTQVASHAQKY 170
                      9****************************9.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.897122175IPR017930Myb domain
SuperFamilySSF466896.88E-15123175IPR009057Homeodomain-like
SMARTSM007177.8E-8124173IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-8126169IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-12126174IPR006447Myb domain, plants
PfamPF002498.6E-10127170IPR001005SANT/Myb domain
CDDcd001673.62E-9127171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MYLKYPALQD LEWEGTLICL PPDLSSLSNN FAPKVLPLSM SPPSETTATR VPPMLPPVED  60
ATYVQPNLQD QLSALQNINS GNNTYDHPQT QFVNSAANQV APMWPGSQIN HSLSRKGSSS  120
KSNECRRWSE EEHRLFLHGL QKYRMGDWIN ISRIIKTRNP TQVASHAQKY FLRQASSNKG  180
KRRSIHDMVL PDGPVPHRIY QQNGVSFPNL DGPITHHIDH QNGVPFQNLI MKELYEIHLA  240
VPHYINQQNW VLRPMR
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN23155.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028238564.14e-32putative mediator of RNA polymerase II transcription subunit 12
TrEMBLA0A0B2QNZ90.0A0A0B2QNZ9_GLYSO; Myb-like protein J
STRINGGLYMA07G08081.12e-31(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3677622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-22Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]