PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN22979.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 170aa    MW: 18623.2 Da    PI: 9.0829
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN22979.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.81.2e-45141131100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++la++++
  KHN22979.1  14 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQDLPMHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQTQLARAQA 112
                 7**********************************************************************************************9997 PP

      DUF260 100 e 100
                 e
  KHN22979.1 113 E 113
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.52113114IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-4514111IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MKEGGGRKQG AASPCAACKL LRRRCAQDCV FAPYFPADEP QKFANVHKVF GASNVNKMLQ  60
DLPMHQRGDA VSSMVYEANA RVRDPVYGCV GAISSLQQQI DVLQTQLARA QAEVAHLRVR  120
QNRCFSNHGL RPTSPTHSGF PSSKTLDSHA KPIFDIDMVD QASYGGSMWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-50101147111LOB family transfactor Ramosa2.1
5ly0_B3e-50101147111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN22979.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150382e-79AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003535054.11e-126LOB domain-containing protein 4
RefseqXP_028180280.11e-126LOB domain-containing protein 4-like
SwissprotQ9SHE92e-77LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0B2QS871e-124A0A0B2QS87_GLYSO; LOB domain-containing protein 4
TrEMBLI1L0C81e-124I1L0C8_SOYBN; Uncharacterized protein
STRINGGLYMA09G02510.11e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.19e-80LOB domain-containing protein 4
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]