PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN22797.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 172aa    MW: 19350.1 Da    PI: 6.4895
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN22797.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.33.1e-4461051100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +Ca+Ck+lrr+C+kdC++apyfp+++p+kf +vhk+FGasn++k+l++lp ++r da+sslvyeA+ar+rdP+yG+vg i+ lq+q++ql+ +la++++
  KHN22797.1   6 PCASCKLLRRRCSKDCIFAPYFPSDDPRKFSIVHKVFGASNISKMLQELPIHQRADAVSSLVYEANARVRDPMYGCVGAISYLQNQVSQLQMQLAVAQT 104
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  KHN22797.1 105 E 105
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6445106IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-436103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MGGTSPCASC KLLRRRCSKD CIFAPYFPSD DPRKFSIVHK VFGASNISKM LQELPIHQRA  60
DAVSSLVYEA NARVRDPMYG CVGAISYLQN QVSQLQMQLA VAQTEILCIQ MQQQEPTLAT  120
QLVDQDDKSM LLSVNNNYEM LPQFLKFPSS SSSSSNVFQD PDEPLKRESF WT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-109AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003537315.21e-125PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-77LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0B2QT211e-126A0A0B2QT21_GLYSO; LOB domain-containing protein 12
STRINGGLYMA11G29450.11e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-77LBD family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]