PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN22296.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 147aa    MW: 16149.7 Da    PI: 6.1419
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN22296.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-181153347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +++++Ed+ ++ a++q+G++ W+tIar ++ gRt++ +k++w++ 
       KHN22296.1 11 PFSAQEDDTIIAAHAQYGNR-WATIARLLP-GRTDNAVKNHWNST 53
                     79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-21457IPR009057Homeodomain-like
PROSITE profilePS5129423.81458IPR017930Myb domain
SuperFamilySSF466896.36E-16464IPR009057Homeodomain-like
SMARTSM007171.3E-15856IPR001005SANT/Myb domain
PfamPF002494.3E-151153IPR001005SANT/Myb domain
CDDcd001671.78E-131154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MTASPAVEHR PFSAQEDDTI IAAHAQYGNR WATIARLLPG RTDNAVKNHW NSTLKRRAKG  60
ININVNHANN EVAASSSAPS RHFDFEDDPL TALTLAPPGI ANGTVAEDAV PDHRASPEGF  120
WDMMRDVIAR EVREYVSSNF SDNSGFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1745854108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN22296.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311920.0KT031192.1 Glycine max clone HN_CCL_38 MYB/HD-like transcription factor (Glyma06g04010.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235925.11e-103MYB transcription factor MYB124
RefseqXP_028234861.11e-103transcription factor MYB44-like
TrEMBLA0A445K4771e-101A0A445K477_GLYSO; Transcription factor MYB77
TrEMBLQ0PJI91e-101Q0PJI9_SOYBN; MYB transcription factor MYB124
STRINGGLYMA06G04010.11e-102(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50743256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.13e-28myb domain protein r1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]