PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN22092.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARR-B
Protein Properties Length: 670aa    MW: 74162.1 Da    PI: 6.2907
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN22092.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.94e-27199252155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kprl+W  eLH++F+ av++L G++kA Pk+il+lm+v+gLt+e+v+SHLQkYRl
  KHN22092.1 199 KPRLVWDAELHRKFLAAVNHL-GIDKAFPKRILDLMNVEGLTRENVASHLQKYRL 252
                 79*******************.********************************8 PP

2Response_reg78.81.9e-2631111109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+++ + +l+++l+k +y +v+++ ++ +ale+l++++  +Dl++ D++mp+mdG++ll+     e++lp+i+++++g++e + + +  Ga 
    KHN22092.1   3 VLAVDDDKTCLTVLENLLRKCQY-NVTTTNQAIKALEMLRKNRnkFDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSGYGDKERVMRGVIQGAC 97 
                   799********************.***************998889*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l+Kp+ +eel +
    KHN22092.1  98 DYLTKPVRIEELQN 111
                   ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004485.0E-321113IPR001789Signal transduction response regulator, receiver domain
PIRSFPIRSF0363921.9E-1421669IPR017053Response regulator B-type, plant
SuperFamilySSF521729.25E-361123IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.4E-411124No hitNo description
PROSITE profilePS5011042.5762117IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.3E-233111IPR001789Signal transduction response regulator, receiver domain
CDDcd001567.04E-284117No hitNo description
Gene3DG3DSA:1.10.10.601.5E-27196256IPR009057Homeodomain-like
PROSITE profilePS5129411.389196255IPR017930Myb domain
SuperFamilySSF466891.79E-18197256IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-24199252IPR006447Myb domain, plants
PfamPF002497.3E-6202251IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 670 aa     Download sequence    Send to blast
MRVLAVDDDK TCLTVLENLL RKCQYNVTTT NQAIKALEML RKNRNKFDLV ISDVNMPDMD  60
GFKLLELVGL EMDLPVIMLS GYGDKERVMR GVIQGACDYL TKPVRIEELQ NIWQHVLRRR  120
IDSKDKNKTA SEGKGCSMAG KFANEEKARY MAGECSQAMA PKNNTDQNIK LGQKRKELSE  180
DEEEEEYDKE NEEHSNQKKP RLVWDAELHR KFLAAVNHLG IDKAFPKRIL DLMNVEGLTR  240
ENVASHLQKY RLGLRKPTQQ PSMVAALGSS DPYLQMDSVE GFRTLSGSVG MLSTTLPSYA  300
SGGVFCRLNP PSGLRGVNSA LFQPVLSQNN SMSAKAFGNM QLSMFSANQT SSLLQGIPTS  360
IDANKFQQNR SPGIRKLSPL DDSSGFKVSS GFSDTRATVI NPNNFVHDLS NNHLLLQRNS  420
PPAQNSGAFR NHSSLGAASV NTQSFDPGIC ELDHNRHNKS WQGTTQISKF PTNTSAVSKV  480
FTHDQLAQNN SKFSSSTFCS GNSPVDFSST RAIAPPLEDA RGKLQSQEGL LENILLASCY  540
TQHQSWESDK RGCNKDMSQT FNSTKSVSPN GDTSSLGHSL DQNNSVSSEG IGASLVNPSI  600
TQSNEGEKFY SMKSNDACIL RSMESQEGLM QNTFGSLNDI MSEITEQEQN TIMLMDGELE  660
FDLDHAFDSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-24197256362ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins (By similarity). Functions as a response regulator in response to cytokinins (PubMed:22383541). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:22383541}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN22092.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028188502.10.0two-component response regulator ARR12-like
SwissprotB8B3I41e-105ORR22_ORYSI; Two-component response regulator ORR22
SwissprotQ5SML51e-105ORR22_ORYSJ; Two-component response regulator ORR22
TrEMBLA0A0B2QQW10.0A0A0B2QQW1_GLYSO; Two-component response regulator
STRINGGLYMA13G22320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-102response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]