PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN21965.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family WOX
Protein Properties Length: 261aa    MW: 29149.3 Da    PI: 5.975
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN21965.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.43.9e-213089357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                +R+++tkeq+  Le+l+++  ++psaee+++++++l    +++ ++V++WFqN++a++++
  KHN21965.1 30 SRWNPTKEQISMLENLYKQgIKTPSAEEIQQITARLraygHIEGKNVFYWFQNHKARQRQ 89
                7*****************99**************************************97 PP

2Wus_type_Homeobox1161.8e-372891265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       a++RW+Pt+eQi +Le+lyk+G++tP++eeiq+ita+L++yG+ie+kNVfyWFQN+kaR+rqkq
         KHN21965.1 28 ASSRWNPTKEQISMLENLYKQGIKTPSAEEIQQITARLRAYGHIEGKNVFYWFQNHKARQRQKQ 91
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.1752590IPR001356Homeobox domain
SMARTSM003898.9E-72794IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.7E-93089IPR009057Homeodomain-like
SuperFamilySSF466897.7E-133097IPR009057Homeodomain-like
PfamPF000467.2E-193089IPR001356Homeobox domain
CDDcd000861.44E-83191No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MESGNNTNHE LEMEMESGGS NGNEGVAASS RWNPTKEQIS MLENLYKQGI KTPSAEEIQQ  60
ITARLRAYGH IEGKNVFYWF QNHKARQRQK QKQETFAYFN RFLHTPQPFF SPPICPNAMC  120
APYYIPQGQG EIGFYPPHQK VFVPVGFRRS PSEKVVPTGM ISSNGPLVYD GMHQMQQRIS  180
DCSNSHFSHQ ETLDLFPLHP TGILEGKTTT TTGQVSSLAS VVSADSSTDT PSADDINEDD  240
HASPLNQPFF DFFTTSGQGS Y
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN21965.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352950.0AC235295.1 Glycine max strain Williams 82 clone GM_WBb0059N17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028187498.10.0WUSCHEL-related homeobox 2
TrEMBLK7LPP60.0K7LPP6_SOYBN; Uncharacterized protein
STRINGGLYMA11G14940.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.13e-53WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]