PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN21944.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 656aa    MW: 74144.2 Da    PI: 6.3591
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN21944.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS372.26.8e-1142836531373
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lL+ cA+avss+d   a++lL++++++asp gd +qRla++f+ AL+arl+++++++y al+ ++ts    ++ ++a++++  ++P+ k+s + aN
  KHN21944.1 283 LRTLLILCAQAVSSDDRMSANELLKQIKQHASPLGDGTQRLAQCFASALEARLVGTGTQIYTALSHKRTS---AADMVKAYQMYISACPFKKLSMIFAN 378
                 5789************************************************************999999...99************************ PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                 ++Il  +++ e++HiiDf+i +G+QWpaL+  L+++p+gpp+lRiTg++ p++g   +e+++etg rL++++++++vpfefn+ +a+++e++++e+L++
  KHN21944.1 379 HTILHLAKEVETLHIIDFGIRYGFQWPALIYRLSKQPGGPPKLRITGIELPQPGfrPAERVQETGLRLTRYCDRFNVPFEFNA-IAQKWETIKIEDLKI 476
                 *****************************************************9*****************************.7************** PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                 k++E l+ n +++ ++llde+v ++s+rd+vLkl+++ +P ++ +++ + ++n++ F++rf eal +ys+lfd l+++++ e+  r + Ere++gr+++
  KHN21944.1 477 KENELLVANAMFRFQNLLDETVVVNSPRDAVLKLIRKANPAIFLHANVNGSYNAPFFVTRFREALFHYSTLFDVLDTNVACEDPMRLMFEREFFGRQVM 575
                 *************************************************************************************************** PP

        GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                 n+vaceg er+er et+++W+ r ++aGFk++pl+++  ++ ++ l+  +   +++ e+++ +++gWk+r +++ S+W
  KHN21944.1 576 NIVACEGCERVERPETYKQWQVRNMRAGFKQLPLDKHLINKLRCKLKDAYHSDFMLLEDDNYMLQGWKGRVVYASSCW 653
                 **************************************************777************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.58257634IPR005202Transcription factor GRAS
PfamPF035142.4E-111283653IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MLMEEDLEAK PCMFHDTLAL QAAEKSFYEV IGETYHSSSI QNYHNMDSPD ESSFSGATTS  60
TSNSFESQWN NVDLADYKPS ILQTTFPADF VFQASSIQSS MNTTSNFAVT NSQFLASSVA  120
GFLDPGSTNL FSKSESVLQF ERGVEEANKF LPKWNPLVFD LENPSFRMVP PQQVKIKAET  180
ERDEISAESR GRKNHEREDE EADLQDGRSN KQSAVYIDDS EISELLDKVL LGTGCRNEQA  240
PSCIGHADLP NGPSLGKLEE TNKSGGGKSH VKKQGSKKEI VDLRTLLILC AQAVSSDDRM  300
SANELLKQIK QHASPLGDGT QRLAQCFASA LEARLVGTGT QIYTALSHKR TSAADMVKAY  360
QMYISACPFK KLSMIFANHT ILHLAKEVET LHIIDFGIRY GFQWPALIYR LSKQPGGPPK  420
LRITGIELPQ PGFRPAERVQ ETGLRLTRYC DRFNVPFEFN AIAQKWETIK IEDLKIKENE  480
LLVANAMFRF QNLLDETVVV NSPRDAVLKL IRKANPAIFL HANVNGSYNA PFFVTRFREA  540
LFHYSTLFDV LDTNVACEDP MRLMFEREFF GRQVMNIVAC EGCERVERPE TYKQWQVRNM  600
RAGFKQLPLD KHLINKLRCK LKDAYHSDFM LLEDDNYMLQ GWKGRVVYAS SCWVPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-452876538374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539083.10.0PREDICTED: scarecrow-like protein 14 isoform X1
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A0B2QP400.0A0A0B2QP40_GLYSO; Scarecrow-like protein 14
STRINGGLYMA11G14750.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]