PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN21721.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 727aa    MW: 80035.3 Da    PI: 6.1479
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN21721.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.91.1e-203388156
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                +++ +++t++q++eLe++F+++++p++++r +L+k+l L+ +qVk+WFqNrR+++k
  KHN21721.1 33 KKRYHRHTPHQIQELEAFFKECPHPDEKQRLDLSKRLALENKQVKFWFQNRRTQMK 88
                688999***********************************************999 PP

2START1801.4e-562434662206
                 HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECT CS
       START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetleviss 87 
                 la++a++el+k+ +ae+p+W ks     e+ n +e+ + f++  +     + +ea r++g+v+ ++  lve+l+d + +W e+++    +a  l+vis+
  KHN21721.1 243 LALAAMEELLKMTQAESPLWIKSLdgekEMFNHEEYARLFSPCIGpkptgYITEATRETGIVIINSLALVETLMDAN-RWAEMFPsmiaRAINLDVISN 340
                 6899********************999999999*******99988********************************.*******99999999****** PP

                 T......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHH CS
       START  88 g......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphw 179
                 g      galq+m ae q+lsplvp R + f+R+++q+ +g+w++vdvS++   +  + ++++ +++lpSg+++++++ng+skvtw+eh++++++++h+
  KHN21721.1 341 GmggtrnGALQVMHAEVQLLSPLVPvRQVRFIRFCKQHAEGVWAVVDVSIEIGHDAANAQPFMSCRRLPSGCIVQDMPNGYSKVTWLEHWEYDENVVHQ 439
                 ***************************************************99999999**************************************** PP

                 HHHHHHHHHHHHHHHHHHHHTXXXXXX CS
       START 180 llrslvksglaegaktwvatlqrqcek 206
                 l+r+l++sg+ +ga +w atlqrqce+
  KHN21721.1 440 LYRPLLSSGVGFGAHRWIATLQRQCEC 466
                 *************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-211784IPR009057Homeodomain-like
SuperFamilySSF466891.33E-191990IPR009057Homeodomain-like
PROSITE profilePS5007117.2973090IPR001356Homeobox domain
SMARTSM003899.5E-183194IPR001356Homeobox domain
CDDcd000866.10E-183290No hitNo description
PfamPF000462.5E-183388IPR001356Homeobox domain
PROSITE patternPS0002706588IPR017970Homeobox, conserved site
PROSITE profilePS5084841.217233469IPR002913START domain
SuperFamilySSF559613.72E-31235466No hitNo description
CDDcd088753.70E-118237465No hitNo description
SMARTSM002342.3E-35242466IPR002913START domain
PfamPF018523.7E-47243466IPR002913START domain
SuperFamilySSF559611.65E-19486668No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MRDDEYESRS GSDNFEGASG DDQDGGDDQP QRKKRYHRHT PHQIQELEAF FKECPHPDEK  60
QRLDLSKRLA LENKQVKFWF QNRRTQMKTQ LERHENIMLR QENDKLRAEN SLMKDAMSNP  120
VCNNCGGPAI PGQISFEEHQ IRIENARLKD ELNRICALAN KFLGKPISSL TNPMALPTSN  180
SGLELGIGRN GIGGSSTLGT PLPMGLDLGD GVLGTQPAMP GIRPALGLMG NEVQLERSML  240
IDLALAAMEE LLKMTQAESP LWIKSLDGEK EMFNHEEYAR LFSPCIGPKP TGYITEATRE  300
TGIVIINSLA LVETLMDANR WAEMFPSMIA RAINLDVISN GMGGTRNGAL QVMHAEVQLL  360
SPLVPVRQVR FIRFCKQHAE GVWAVVDVSI EIGHDAANAQ PFMSCRRLPS GCIVQDMPNG  420
YSKVTWLEHW EYDENVVHQL YRPLLSSGVG FGAHRWIATL QRQCECLAIL MSSSISSDDH  480
TALSQAGRRS MLKLAQRMTS NFCSGVCASS ARKWDSLHIG TLGDDMKVMT RKNVDDPGEP  540
PGIVLSAATS VWVPVSRQRL FDFLRDERLR SEWDILSNGG PMQEMVHIAK GQGHGNCVSL  600
LRANAVNAND SSMLILQETW MDASCSVVVY APVDVQSLNV VMSGGDSAYV ALLPSGFAIL  660
PDGHCNDNGC NGSLQKGRGS DDGLLTVGFQ ILVNSLPTAK LTVESVDTVN NLISCTIQKI  720
KASLRVA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN21721.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028186012.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A0B2QJW50.0A0A0B2QJW5_GLYSO; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
STRINGGLYMA10G38280.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]