PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN21539.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 171aa    MW: 19065.7 Da    PI: 6.2373
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN21539.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.81.6e-4231021100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++k+l++lpe++r da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+la++++
  KHN21539.1   3 PCAACKILRRRCAEKCVLAPYFPPTEPAKFTTAHRVFGASNIIKFLQELPESQRADAVASMVYEAGARIRDPVYGCAGAICHLQKQVNELQAQLAKAQA 101
                 7***********************************************************************************************997 PP

      DUF260 100 e 100
                 e
  KHN21539.1 102 E 102
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.682103IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-433100IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MIPCAACKIL RRRCAEKCVL APYFPPTEPA KFTTAHRVFG ASNIIKFLQE LPESQRADAV  60
ASMVYEAGAR IRDPVYGCAG AICHLQKQVN ELQAQLAKAQ AEVVNMQFQQ ANLVALICME  120
MAQTQTPQES PQQSVDNFIS SPSHSSGYQN NLNFFEENTN NLNSLWEPLW T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-41310511113LOB family transfactor Ramosa2.1
5ly0_B1e-41310511113LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN21539.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0971751e-118BT097175.1 Soybean clone JCVI-FLGm-21N19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003542002.11e-126LOB domain-containing protein 1
RefseqXP_028188659.11e-126LOB domain-containing protein 1-like
SwissprotQ9SK082e-77LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A445IDF41e-125A0A445IDF4_GLYSO; LOB domain-containing protein 11
TrEMBLK7M3861e-125K7M386_SOYBN; Uncharacterized protein
STRINGGLYMA13G40370.21e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.19e-68LOB domain-containing protein 11