PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN21323.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 130aa    MW: 14407.7 Da    PI: 7.3635
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN21323.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.41.2e-111446134
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkg 34
                     +g+WT+eEd++lv+ ++++G g+W++ ++  g  
       KHN21323.1 14 KGPWTPEEDQKLVQHIQKHGHGSWRALPKQAG-L 46
                     79**************************9998.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-14543IPR009057Homeodomain-like
PROSITE profilePS5129410.184954IPR017930Myb domain
SuperFamilySSF466891.58E-91143IPR009057Homeodomain-like
PfamPF002494.9E-101447IPR001005SANT/Myb domain
CDDcd001672.71E-81647No hitNo description
SuperFamilySSF533834.82E-742114IPR015424Pyridoxal phosphate-dependent transferase
Gene3DG3DSA:3.40.640.101.1E-644114IPR015421Pyridoxal phosphate-dependent transferase, major region, subdomain 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0004398Molecular Functionhistidine decarboxylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTPE EDQKLVQHIQ KHGHGSWRAL PKQAGLREVF PNGILYASQE  60
SHYSVFKAAR MYIMECVKIN TLWSGEIDCD GFEAKLLCHK DKPGIVDVNI GSTSIVMGLC  120
LVSCCLLSNV
Functional Description ? help Back to Top
Source Description
UniProtCatalyzes the biosynthesis of ethanolamine from serine. Decarboxylation of free serine is the major source of ethanolamine production in plants and ethanolamine metabolism is crucial for the synthesis of choline, phosphatidylethanolamine (PE) and phosphatidylcholine (PC), and thus for plant growth (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN21323.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0940472e-88BT094047.1 Soybean clone JCVI-FLGm-24J3 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006591667.11e-54serine decarboxylase 1-like
SwissprotQ6ESZ94e-28SDC1_ORYSJ; Serine decarboxylase 1
TrEMBLA0A0B2QN639e-93A0A0B2QN63_GLYSO; Histidine decarboxylase
STRINGGLYMA11G25641.14e-54(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.14e-27myb domain protein 107
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]