PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN21148.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 401aa    MW: 44759.3 Da    PI: 7.6141
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN21148.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.31.5e-3246100155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kprl+Wtp+LH+rF+eav+qLGG++kAtPkt+++l++++gLtl+h+kSHLQkYRl
  KHN21148.1  46 KPRLKWTPDLHARFIEAVQQLGGADKATPKTVMKLIGIPGLTLYHLKSHLQKYRL 100
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.29743103IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2944101IPR009057Homeodomain-like
SuperFamilySSF466891.65E-1545101IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-2246101IPR006447Myb domain, plants
PfamPF002495.0E-94899IPR001005SANT/Myb domain
PfamPF143794.5E-20147192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MYTHQQHQGK NIHSSSRMPI PSERQMFLQT GNGSGDSGLV LSTDAKPRLK WTPDLHARFI  60
EAVQQLGGAD KATPKTVMKL IGIPGLTLYH LKSHLQKYRL SKSLHGQSNN MTHKISAATD  120
ERLRENNGTH MNSLNLAPQS NNKDLYISEA LHMQIEEQRR LNEQLEVQRL LQLRIEAQGK  180
YLQAVLEKAQ ETLGRQNLGA VGLEATKLQL SELVSKVSSQ CLNSAFSDRL KEIQGCSPHQ  240
QTQTNQPNTN DCSMDSCLTS CEGSQKEQEI QNGGMSLRPF NVHTFMERKE VIEGPNLNNL  300
PNTDLNWCDP VKKNTFLTPL SMHADKRSPS NLSMSIGLEG ETENGSTIRT ESVKPVADKV  360
SQDYGLPSNY FAASKLDLTT EDNKDTKTSC KQLDLNGFSW N
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0959460.0BT095946.1 Soybean clone JCVI-FLGm-25M4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592327.10.0PREDICTED: uncharacterized protein LOC100805237
RefseqXP_003539830.10.0PREDICTED: uncharacterized protein LOC100805237
TrEMBLA0A0B2QMP40.0A0A0B2QMP4_GLYSO; Myb family transcription factor APL
STRINGGLYMA12G09490.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38523163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-110G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]