PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN21018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 328aa    MW: 36402.7 Da    PI: 7.9672
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN21018.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.3e-32135188255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  KHN21018.1 135 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 188
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-15132189IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-28133189IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-23135188IPR006447Myb domain, plants
PfamPF002492.1E-7136187IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MFTNSHTVMQ TLLSPLAEPD LSLNISPPSI SDSEAAKDVG SFGKVLYSDI CSTSDSGSSG  60
GSDLSHEFHN LGHHHHREPT LKLGFGTVDL NPHHHQVQGV PRSFIHHHLQ PHIYGRDFKR  120
SARVVHGVKR SVRAPRMRWT TTLHAHFVHA VQLLGGHERA TPKSVLELMN VKDLTLAHVK  180
SHLQMYRTVK STDKGITAAG HGQTGIGLMN PRPGINVHLH ALSPICDTTN LPDPIQSSHR  240
TPWQSSIETK TNNRRQEEPE IGLTYSHLKG NNNNNETTVD GHNNYGGLDS TPLSRSEEAM  300
LDLEFTLGRP NWQKDHTESS RELTLLKC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550354.10.0PREDICTED: probable transcription factor KAN4
TrEMBLA0A0B2QMB00.0A0A0B2QMB0_GLYSO; Putative transcription factor KAN4
STRINGGLYMA17G36500.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.13e-63G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]