PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN20452.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 434aa    MW: 48525.3 Da    PI: 6.9784
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN20452.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS423.61.7e-129644331373
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lL+ cA+a+s+++++  ++l+++ +  +s +g+p+qRl ay++e+L ar   s++++y+al+++e +    ++ l++++l++e++P+lkf++++aN
  KHN20452.1  64 LKQLLIVCAKALSENNMQHFDQLIEKARSAVSITGEPIQRLGAYLVEGLVARKEASGNNIYHALRCREPE---GKDLLSYMQLLYEICPYLKFGYMAAN 159
                 679******************************************************************9...9************************* PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  aI ea  +e+++HiiDf+i+qG+QW++LlqaLa+Rp+g+p++RiTg+++p s+  + + le++g+rLa + +++++++ef+  v     d++ + L+v
  KHN20452.1 160 GAIAEACRNEDQIHIIDFQIGQGTQWVTLLQALAARPGGAPHVRITGIDDPLSKyvRGDGLEAVGKRLAAISQTFNIRVEFHG-VPVLAPDVTKDVLDV 257
                 **************************************************999999***************************.677889999****** PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                 +pgEalaVn+ lqlh++ desv+++++rd +L+lvkslsPkv ++veqe+++n+++F++rf+e+l+yy a+f+s++++lpr+s+ +i++E+++l+r+iv
  KHN20452.1 258 RPGEALAVNFPLQLHHTADESVDMSNPRDGLLRLVKSLSPKVTTLVEQESNTNTTPFFNRFIETLDYYLAMFESIDVSLPRKSKVQINMEQHCLARDIV 356
                 *************************************************************************************************** PP

        GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                 n++aceg+er+erhe l+kW++rl++aGF+++pls+++++ +++llr ++ + y++ e++g+++lgWkdr+L+s+SaW
  KHN20452.1 357 NIIACEGKERVERHELLGKWKSRLTMAGFRQYPLSSYMNSVIRSLLRCYS-KHYNLVEKDGAMLLGWKDRNLISTSAW 433
                 **********************************************9999.55************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.05538415IPR005202Transcription factor GRAS
PfamPF035145.8E-12764433IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MAPDGEDQIT TSSTSLGVGS RPTTSCQRNR SWSSEGQSSD VAHVEKHHKS VEEESLQGFP  60
SCNLKQLLIV CAKALSENNM QHFDQLIEKA RSAVSITGEP IQRLGAYLVE GLVARKEASG  120
NNIYHALRCR EPEGKDLLSY MQLLYEICPY LKFGYMAANG AIAEACRNED QIHIIDFQIG  180
QGTQWVTLLQ ALAARPGGAP HVRITGIDDP LSKYVRGDGL EAVGKRLAAI SQTFNIRVEF  240
HGVPVLAPDV TKDVLDVRPG EALAVNFPLQ LHHTADESVD MSNPRDGLLR LVKSLSPKVT  300
TLVEQESNTN TTPFFNRFIE TLDYYLAMFE SIDVSLPRKS KVQINMEQHC LARDIVNIIA  360
CEGKERVERH ELLGKWKSRL TMAGFRQYPL SSYMNSVIRS LLRCYSKHYN LVEKDGAMLL  420
GWKDRNLIST SAWY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-62614331374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592516.10.0PREDICTED: scarecrow-like protein 21 isoform X1
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLK7LUN80.0K7LUN8_SOYBN; Uncharacterized protein
STRINGGLYMA12G16750.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-175GRAS family protein