PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN20305.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 292aa    MW: 34854.3 Da    PI: 7.4212
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN20305.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix80.32.8e-2536118186
    trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                 +W+ qe+++ + +r e+++++ ++k++k+lWe +s++m+e+gf+rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  KHN20305.1  36 QWSIQETKEFLVIRAELDQTFMETKRNKQLWEVISNRMKEKGFHRSAEQCKCKWKNLVTRYKGCETMEPEA---MRQQFPFYNELQ 118
                 7********************************************************************95...56689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122033.87E-2235100No hitNo description
PfamPF138372.5E-2036120No hitNo description
PROSITE profilePS500907.3173793IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MEGHHLHHRQ QQLQQHHHPH HNITTSNVDA TDRFPQWSIQ ETKEFLVIRA ELDQTFMETK  60
RNKQLWEVIS NRMKEKGFHR SAEQCKCKWK NLVTRYKGCE TMEPEAMRQQ FPFYNELQAI  120
FAARMQRMLW AEAEGGGSNN KKKGMHLSSD DEEEGNEEMM SEGDHKGNII ISKKNKKKGK  180
MVIGVGGSGN NNNSSSSSNN LESLKEIMDE FMRQQMQMEA QWMEAFEARE NERRLKEMEW  240
RQTMEALENE RLMMDQRWRE REEQRRIREE VRADKRDALI TALLNKLRRE EM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-103AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003551560.11e-160PREDICTED: trihelix transcription factor GT-3b-like
SwissprotQ9SDW02e-74TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A0B2QGG40.0A0A0B2QGG4_GLYSO; Trihelix transcription factor GT-3a
STRINGGLYMA18G43190.21e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.13e-56Trihelix family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]