PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN20036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GATA
Protein Properties Length: 281aa    MW: 31455.3 Da    PI: 6.6178
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN20036.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.12.4e-18198231134
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                 Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  KHN20036.1 198 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 231
                 *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.4E-6721280IPR016679Transcription factor, GATA, plant
SuperFamilySSF577165.7E-13192253No hitNo description
PROSITE profilePS5011411.688192228IPR000679Zinc finger, GATA-type
SMARTSM004016.8E-11192246IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.2E-14196229IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.26E-14197254No hitNo description
PfamPF003203.3E-16198231IPR000679Zinc finger, GATA-type
PROSITE patternPS003440198223IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MEVAVAKALK PSLRSEFIVQ KMHCEDIFSL NANTVAVGED FSVDDLFDFS NGSLHNEHQQ  60
ECDEEKQSLS ASSQSQDRGE DDSNSNSTGV SYDSLFSTEL AVPAGDLEDL EWVSHFVDDS  120
LPELSLLYPV RSEEANRFVE PEPSVKKTPR FPWEMKITSK ARSVRNRKPN TRVWSLGSTL  180
LSLPSSPPAK KQKKRVECSH CQVQKTPQWR TGPLGAKTLC NACGVRYKSG RLFSEYRPAC  240
SPTFCSDIHS NSHRKVLEIR KRKEVAEPDT GLAQTQMVPT C
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351551e-110AC235155.1 Glycine max strain Williams 82 clone GM_WBa0087H06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527135.10.0PREDICTED: GATA transcription factor 7-like
TrEMBLA0A0B2QEN40.0A0A0B2QEN4_GLYSO; GATA transcription factor 7
STRINGGLYMA06G01110.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.11e-52GATA transcription factor 7
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]