PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19594.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 192aa    MW: 21706.2 Da    PI: 9.4906
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19594.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.13.8e-4136111277
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 Cqv gC++dls +k+yh+rhkvCevhsk+ +v+v+g+eqrfCqqCsrfh l efD++krsCr+ La+hnerrrk+q
  KHN19594.1  36 CQVYGCNKDLSGCKDYHKRHKVCEVHSKTYKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKCLAGHNERRRKPQ 111
                 **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.3E-342997IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.57333110IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-3834114IPR004333Transcription factor, SBP-box
PfamPF031101.5E-3036109IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MVPTFSKGAP ILSLLESSTP PKRVRALGAH SQTAYCQVYG CNKDLSGCKD YHKRHKVCEV  60
HSKTYKVIVN GIEQRFCQQC SRFHLLAEFD DGKRSCRKCL AGHNERRRKP QVGIHSGKAG  120
RLLQLYPDSR FQETMLTSSF ICQEILPSGV LSYEKYEASD WRPIKTPMPV IQFLNNVGHS  180
GEKLKMVIGI CC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-29361091184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN19594.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028236608.11e-117squamosa promoter-binding-like protein 6
SwissprotQ94JW82e-47SPL6_ARATH; Squamosa promoter-binding-like protein 6
TrEMBLA0A0B2QH731e-141A0A0B2QH73_GLYSO; Squamosa promoter-binding-like protein 6
STRINGGLYMA04G32002.11e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.18e-50SBP family protein
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  3. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]