PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19503.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 249aa    MW: 28553.8 Da    PI: 8.3817
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19503.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK75.56.3e-24141188552
      RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 +++++++k+F  pi++AAk L+v+lT+LKr+CR++++kRWPhRk+ksl
  KHN19503.1 141 LKFDEIRKHFGVPITEAAKRLNVGLTMLKRRCRELNVKRWPHRKLKSL 188
                 899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.756126209IPR003035RWP-RK domain
PfamPF020427.0E-22141188IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGFVFVSDHD IVPHTFNSSF SSAQVNHTHK IMEISPLEGF SELDWPYSSN HLCFNEFPDL  60
ENLDLDFSLP PLGEYLEEEL DQKPLNIVVS QGVHCNREKG FGEASSFTIE NGSATASYVQ  120
NIIHQRPQPV SSSSKKKTCV LKFDEIRKHF GVPITEAAKR LNVGLTMLKR RCRELNVKRW  180
PHRKLKSLQL LIDNVKEMGL EDEVARLEKH KRLLEKLPGM ELSEEAKKLR QACFKANYKK  240
RRCMASLQA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1883703e-61AC188370.9 Glycine max cultivar PI 96983 clone gmp1-120k16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578896.10.0PREDICTED: protein RKD4-like isoform X1
TrEMBLA0A0B2QHV90.0A0A0B2QHV9_GLYSO; Protein RKD4
STRINGGLYMA04G41320.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.11e-34RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]