PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19353.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 304aa    MW: 32781.6 Da    PI: 7.7918
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19353.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.3e-1491135347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r   k+Rt+ q+ s+ qky
       KHN19353.1  91 PWTEEEHKLFLVGLQKVGKGDWRGISRNYVKTRTPTQVASHAQKY 135
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.51984140IPR017930Myb domain
SuperFamilySSF466896.58E-1786140IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-1687138IPR006447Myb domain, plants
SMARTSM007174.6E-988138IPR001005SANT/Myb domain
CDDcd001671.30E-991136No hitNo description
Gene3DG3DSA:1.10.10.601.5E-1091135IPR009057Homeodomain-like
PfamPF002492.4E-1191135IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MPLSSSSSSA VDSAVSGEIM LFGVRVVVDS MRKSVSMNNL SQYELPRDAA NAKDDAAGYA  60
SADDAAPINS DADDAAPINS GKNRDRKRGI PWTEEEHKLF LVGLQKVGKG DWRGISRNYV  120
KTRTPTQVAS HAQKYFLRRT NLNRRRRRSS LFDITTDSVS TTPMEEGVQI QHQDNVSLFH  180
PVYPVTPEGS NMNGFPKMSM YPKDVGSGVM SVQAGNPMET LTLGQGNVEQ NGPSTKLVCT  240
TPIVPDHRGS TVSDITASLS SIDPPTLSLG LSLSSSPRQT SSSIHAALHA LPYFNNQDSI  300
ISAA
Functional Description ? help Back to Top
Source Description
UniProtBinds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN19353.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311900.0KT031190.1 Glycine max clone HN_CCL_89 MYB/HD-like transcription factor (Glyma04g34720.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235999.11e-170MYB transcription factor MYB183
RefseqXP_028237179.11e-170transcription factor MYB1R1-like
SwissprotQ2V9B04e-63MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A445KBQ91e-169A0A445KBQ9_GLYSO; Transcription factor MYB1R1
TrEMBLQ0PJI21e-169Q0PJI2_SOYBN; MYB transcription factor MYB183
STRINGGLYMA06G19960.11e-170(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42483154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.27e-52MYB_related family protein
Publications ? help Back to Top
  1. Shin D, et al.
    Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance.
    Plant Physiol., 2011. 155(1): p. 421-32
    [PMID:21030505]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]