PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN18911.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 148aa    MW: 16731 Da    PI: 9.8776
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN18911.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.21.5e-373896260
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                +ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnv vG+grrk k+
  KHN18911.1 38 AEKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKSCQRYWTAGGALRNVAVGAGRRKAKS 96
                57899***************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-273795IPR003851Zinc finger, Dof-type
PfamPF027011.1E-314096IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.5594296IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MGEESQGIKL FGALITLKGG EVKKGEKGSE YERVEKRAEK IIPCPRCKSM ETKFCYFNNY  60
NVNQPRHFCK SCQRYWTAGG ALRNVAVGAG RRKAKSPCHG AGDFMDGRAY ETSEDENRFE  120
MNQGHVAMPN THFRQIFQAK RQRITSGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF2217521e-133EF221752.1 Glycine max Dof10 transcription factor (Dof10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014622989.11e-109PREDICTED: cyclic dof factor 4-like isoform X1
SwissprotO229672e-43CDF4_ARATH; Cyclic dof factor 4
TrEMBLA0A0B2QBC71e-109A0A0B2QBC7_GLYSO; Dof zinc finger protein DOF2.3
STRINGGLYMA15G08860.11e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64833251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.11e-42Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]