PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN18422.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 362aa    MW: 40607.6 Da    PI: 6.176
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN18422.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++++++G g+W+++++  g+ R++k+c++rw +yl
       KHN18422.1 14 KGLWSPEEDEKLFNYITRFGVGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-25664IPR009057Homeodomain-like
PROSITE profilePS5129424.074965IPR017930Myb domain
SuperFamilySSF466898.39E-2312102IPR009057Homeodomain-like
SMARTSM007174.1E-121363IPR001005SANT/Myb domain
PfamPF002492.3E-141461IPR001005SANT/Myb domain
CDDcd001673.63E-111761No hitNo description
Gene3DG3DSA:1.10.10.601.7E-1565110IPR009057Homeodomain-like
SMARTSM007170.004866108IPR001005SANT/Myb domain
PROSITE profilePS5129411.58866110IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGRHSCCVKQ KLRKGLWSPE EDEKLFNYIT RFGVGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQKEEDLIIS LHEVLGNSKL PGRTDNEIKN FWNSCLKKKL LKQGIDPSTH  120
KPLTEAHVKE EKKITETLSP MQTPLSQGSS VPLIFPSSQG SSLLISDSNY YDGGLKEASR  180
EIFMTKPALD PLSYYDFPMG VAQSGFNLPM SQYQTSLKAS DQNPFGPNSS YVFSTMPSLT  240
NSDHGNVSVT EFSDNNSASK ISSLFMSDQV KESSSNSSNM STIYPISSSM MENAGFSLWE  300
GDNKFDPLFQ FQVNATKSED FKTSSWEEEQ LHTQNSIDFT SFPLTSLSED LTGANFDVFQ  360
HI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-22121105108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN18422.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525561.10.0myb-related protein 330
RefseqXP_028231551.10.0myb-related protein 330-like
TrEMBLA0A445G4330.0A0A445G433_GLYSO; Transcription factor MYB86
TrEMBLI1MTD70.0I1MTD7_SOYBN; Uncharacterized protein
STRINGGLYMA17G09310.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58313353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-77myb domain protein 86
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]