PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN18377.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 394aa    MW: 44296.1 Da    PI: 9.0654
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN18377.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.91.3e-42167242277
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 Cqv gC++dls++k+yh+rhkvCevhsk++ v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  KHN18377.1 167 CQVYGCNKDLSSCKDYHKRHKVCEVHSKTAIVIVDGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 242
                 **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-33161228IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.573164241IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.16E-39165244IPR004333Transcription factor, SBP-box
PfamPF031101.0E-31167240IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MESWSYIPEE KECVSNEAPS PPNTLGRSKN SFLGWELKTP CGFSTDMLGL GHHSIENQGF  60
EELGFPEMLG KHMSDDLVAS VPTRKVDGNR QQQQHHSDRI TGTVVDAPSG FSQRGDSNSL  120
IDLKLGRFAE HGDFTDPAFS KVLSSSESST PPKRVRTSGL HSQTAYCQVY GCNKDLSSCK  180
DYHKRHKVCE VHSKTAIVIV DGIEQRFCQQ CSRFHLLAEF DDGKRSCRKR LAGHNERRRK  240
PQMGIHPGKS GTLLQPCGDS RFQGSMLTSS FIRPEMLPSG VMCSEKYGMS DFWRPIKAEH  300
GTGFRNLSSM AATNGHPLPR SLFSSYNGKQ FPFLHENSHG DKVKERDIVA NFPFVKKLVV  360
KHVKDTPMPI ILRQCRPQGN RNFKWCHSVA NYLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-291672401184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN18377.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2209780.0KF220978.1 Glycine max cultivar Williams 82K clone 6f7r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209790.0KF220979.1 Glycine max cultivar Sowon clone 6f7r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209800.0KF220980.1 Glycine max cultivar Pureun clone 6f7r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209810.0KF220981.1 Glycine max cultivar Kwangkyo clone 6f7r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209820.0KF220982.1 Glycine max cultivar Ilpumgeomjeong clone 6f7r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209830.0KF220983.1 Glycine max cultivar Seoritae clone 6f7r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209840.0KF220984.1 Glycine max cultivar PI96983 clone 6f7r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209850.0KF220985.1 Glycine max cultivar Haman clone 6f7r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209860.0KF220986.1 Glycine max cultivar Geomjeongol clone 6f7r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209870.0KF220987.1 Glycine max cultivar Hwangkeum clone 6f7r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006600599.10.0teosinte glume architecture 1
RefseqXP_028211731.10.0teosinte glume architecture 1-like
TrEMBLA0A445G3T70.0A0A445G3T7_GLYSO; Squamosa promoter-binding-like protein 6 isoform A
TrEMBLK7MKJ40.0K7MKJ4_SOYBN; Uncharacterized protein
STRINGGLYMA17G08840.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-54SBP family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]