PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN18331.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARR-B
Protein Properties Length: 671aa    MW: 74075.9 Da    PI: 5.2331
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN18331.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.22.8e-26199252155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kprl+W  eLH++F+ a+++L G++kA Pk+il+lm+v+gLt+e+++SHLQkYRl
  KHN18331.1 199 KPRLVWDAELHRKFLAAINHL-GIDKAFPKRILDLMNVEGLTRENIASHLQKYRL 252
                 79*******************.********************************8 PP

2Response_reg81.23.4e-2731111109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+++ +++l+++l+k +y +v+++ ++ +al++l++++  +Dl++ D++mp+mdG++ll+  +  e++lp+i+++++g++e + + +  Ga 
    KHN18331.1   3 VLAVDDDETCLSVLENLLRKCQY-NVTTTNQAIKALDMLRKNRnkFDLVISDVNMPDMDGFKLLELVEL-EMDLPVIMLSGYGDKERVMRGVIHGAC 97 
                   799********************.***************998889*******************87655.669************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l+Kp+ +eel +
    KHN18331.1  98 DYLTKPVRIEELQN 111
                   ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.8E-411124No hitNo description
SuperFamilySSF521721.57E-351124IPR011006CheY-like superfamily
PIRSFPIRSF0363922.1E-1431671IPR017053Response regulator B-type, plant
SMARTSM004481.3E-321113IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.9022117IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.8E-243111IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.42E-284116No hitNo description
Gene3DG3DSA:1.10.10.607.3E-27196256IPR009057Homeodomain-like
PROSITE profilePS5129411.39196255IPR017930Myb domain
SuperFamilySSF466892.69E-18197256IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-24199252IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 671 aa     Download sequence    Send to blast
MRVLAVDDDE TCLSVLENLL RKCQYNVTTT NQAIKALDML RKNRNKFDLV ISDVNMPDMD  60
GFKLLELVEL EMDLPVIMLS GYGDKERVMR GVIHGACDYL TKPVRIEELQ NIWQHVVRRR  120
IDSKDKNKTA SEGKACSMAG KLANEEKACY MAGECSQAMA SKSNADQNIK LGQKRKEQSE  180
DEEEEEYDQE NEEPSNQKKP RLVWDAELHR KFLAAINHLG IDKAFPKRIL DLMNVEGLTR  240
ENIASHLQKY RLGLKKSTQQ PSMVATLGNS DPYQQMDSIE GFRTLSGSGG MISTTLPSYA  300
SGGLFCRLNS PSGLRGINSS LLVQPVHSQN IDSRSIKTLG NMQLSMFSAN QTSSLLQGIP  360
TSIDGNQFQQ NNCSIGIRKL SPLDDLSSGF KVSSGFSNSR ATVRNPNNSL HGLSNNHLLL  420
QGNSPPTHNS GAFGNHSSLG AASVKTQSFD PGICELGYNR CNKSWQGTTQ ISKFPANTSA  480
VSNNDQLAQN NLNFSSSTFC SGNSPVDFSS TSVVAPPLED ARGKLRCQEG LLENILLTSC  540
YTQHQSWEAD NRGCNKEMSQ TFNTIKSVSP NGDTSSLGHS LDQNNTVSSK RIDVSLVNPS  600
VTQSSEDEKF YSMESIDGCI LQSMESQEDL MQNTFESLDD IMSEITKQEQ NAIMLMDGEM  660
EFDAYHVGSC I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-25197256362ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN18331.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006600557.10.0two-component response regulator ARR12 isoform X1
RefseqXP_028208240.10.0two-component response regulator ARR12-like isoform X1
TrEMBLA0A445G3J10.0A0A445G3J1_GLYSO; Two-component response regulator
TrEMBLK7MKF20.0K7MKF2_SOYBN; Two-component response regulator
STRINGGLYMA17G08380.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-103response regulator 12
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]