PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN17995.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family YABBY
Protein Properties Length: 181aa    MW: 20310.1 Da    PI: 8.5898
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN17995.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY221.42.5e-6861585170
       YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklse 103
                  ++e+vCyv+CnfCnt lavsvP +sl+++vtvrCGhC++ll+vn+  + q+ ++++             ++ ++++l++++  +++  +s + +++++
  KHN17995.1   6 MATERVCYVHCNFCNTTLAVSVPCSSLLTIVTVRCGHCANLLTVNMGASLQTFPSQDT------------TQLQRQHLSVQEACSKELGSSSKCKSFET 92 
                 579****************************************************996............33333334333333333333334444556 PP

       YABBY 104 nedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                  ++e+ pr+pp irPPekrqrvPsaynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl
  KHN17995.1  93 VDHEQQPRIPP-IRPPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 158
                 66777899999.9****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046905.3E-747158IPR006780YABBY protein
SuperFamilySSF470952.09E-8103151IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.7E-5106152IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MSMDMMATER VCYVHCNFCN TTLAVSVPCS SLLTIVTVRC GHCANLLTVN MGASLQTFPS  60
QDTTQLQRQH LSVQEACSKE LGSSSKCKSF ETVDHEQQPR IPPIRPPEKR QRVPSAYNRF  120
IKEEIQRIKA SNPDISHREA FSTAAKNWAH FPHIHFGLKL DGNKQAKLDQ GDGTQKSNGF  180
Y
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN17995.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0951270.0BT095127.1 Soybean clone JCVI-FLGm-6F4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001276158.11e-136protein YABBY 12
RefseqXP_028193109.11e-136putative axial regulator YABBY 2 isoform X5
SwissprotQ9XFB03e-79YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLA0A0B2Q9P51e-135A0A0B2Q9P5_GLYSO; Putative axial regulator YABBY 2
TrEMBLC6TC481e-135C6TC48_SOYBN; Uncharacterized protein
STRINGGLYMA13G38750.11e-135(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112434112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.14e-71YABBY family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Sacharowski SP, et al.
    SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development.
    Plant Cell, 2015. 27(7): p. 1889-906
    [PMID:26106148]