PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN17743.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARF
Protein Properties Length: 1189aa    MW: 132764 Da    PI: 6.4732
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN17743.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.31.2e-22178279199
                 EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                 f+k+lt sd++++g +++p++ ae++      +++++  ++l+ +d++ ++W +++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   ++++++l+
  KHN17743.1 178 FCKTLTASDTSTHGGFSVPRRAAEKIlppldySMQPPA-QELVAKDLHDNTWAFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI--RDEKQHLL 273
                 99*****************************9545444.38************************************************..5689999* PP

                 EEEE-S CS
          B3  94 vkvfrk 99 
                 ++++r+
  KHN17743.1 274 LGIRRA 279
                 ***997 PP

2Auxin_resp119.33e-39304386183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aahaa+++s+F+++YnPras+seFvv+++k++ka++++vs+GmRf+m+fete+s  r ++Gt++g+sdldpvrW+ S+Wr+++
  KHN17743.1 304 AAHAAANNSPFTIFYNPRASPSEFVVPLAKYNKAMYTQVSLGMRFRMMFETEESGVRGYMGTITGISDLDPVRWKSSQWRNIQ 386
                 79******************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.66E-43168307IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.7E-41170293IPR015300DNA-binding pseudobarrel domain
CDDcd100172.79E-18177278No hitNo description
PfamPF023621.3E-20178279IPR003340B3 DNA binding domain
PROSITE profilePS5086312.012178280IPR003340B3 DNA binding domain
SMARTSM010194.9E-22178280IPR003340B3 DNA binding domain
PfamPF065072.4E-34304386IPR010525Auxin response factor
PfamPF023091.2E-810581147IPR033389AUX/IAA domain
PROSITE profilePS5174524.69210611154IPR000270PB1 domain
SuperFamilySSF542772.16E-810741139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1189 aa     Download sequence    Send to blast
MATKFYFGLL DIISFTRFPF FADADGFISA QSAVGFGVLI CATTRIPLLG VIMKAPSNGY  60
LPNSGEGERK TMNSELWHAC AGPLVSLPPV GSLVVYFPQG HSEQVAASMQ KEADFIPSYP  120
NLPSKLICML HNVALHADPE TDEVYAQMTL QPVNKYEKEA ILASDMGLKQ NRQPTEFFCK  180
TLTASDTSTH GGFSVPRRAA EKILPPLDYS MQPPAQELVA KDLHDNTWAF RHIYRGQPKR  240
HLLTTGWSVF VSTKRLFAGD SVLFIRDEKQ HLLLGIRRAN RQQPALSSSV ISSDSMHIGI  300
LAAAAHAAAN NSPFTIFYNP RASPSEFVVP LAKYNKAMYT QVSLGMRFRM MFETEESGVR  360
GYMGTITGIS DLDPVRWKSS QWRNIQVGWD ESTAGERPRR VSIWEIEPVV TPFYICPPPF  420
FRPKFPRQPG MPDDESDMEN AFKRAVPWLG DDFGMKDASS SIFPGFSLMQ WMSMQQNNQL  480
SAAQSGCFPS MLSSNTLQGN LSTDDPSKLL SFQAPVLSTP SLQLNKPNLP NQINQLQQSP  540
VSWPQQQQLQ QQQQQQQQQQ QQQQQQQQQQ QQQQQQQLQS LLQIPMNQLQ QQRQQQLPEP  600
QNLPLLQQLP QHLGQQPQKQ QQSSQHATIM NNGVVASNQI TNQFAQQPMA YGQLQQQQLL  660
SGGIQPQQGI QSATKNTFPL TSLPQDSQFQ QQIDQQASLL QRQQQQQQTQ LQQSPLQLLQ  720
QNLPQRALQQ PPATQMLQQN PSEQQLHLQL LQKLQQQQQQ QLLSTSTPLL QSQLLQQQNT  780
HQQNQQSLQP LPPISQHQPQ QLGNNAFSTE KLLSSNNFSS SLTQSQQLSM NQPQNTQKSH  840
TITRAPSTLT DGDAPSCSTS PSTNNCQVSP PNLLKRNQQI PATLGGGLIV EPTSNLIQEL  900
HSKPDTQIKQ ELLNVKGPDQ LKYKGTITDP LEASSSGTSY CLDPGNVQQN LPLSNFCMER  960
DVQSHPRNSL PFDSNLDGLT PDTMLLRGYD SQKDLQNLLS NYASAPRDIE TELSTADISS  1020
QSFGVPNMPF KPGCSSDVGI NDTGVLNNNN GLRTNQTPRM RTYTKVQKRG SVGRCIDVTR  1080
YKGYDELRHD LARMFGIEGQ LEDPLRTDWK LVYVDHENDI LLVGDDPWDE FVSCVQSIKI  1140
LSSAEVQQMS LDGDLGGNVP IPNQACSGTD SGNAWRGQYE DNSAASFNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1686740745388Auxin response factor 5
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN17743.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028208829.10.0auxin response factor 19-like
TrEMBLA0A445G1Z40.0A0A445G1Z4_GLYSO; Auxin response factor
STRINGGLYMA17G05220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49183352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]