PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN16664.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 317aa    MW: 35951.8 Da    PI: 5.8907
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN16664.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.21.6e-07154197246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T +Ed+l+  + +  G+ + ++Ia+ ++ gRt+++ k++w++
       KHN16664.1 154 GDFTRQEDQLICTLYATIGTMHVSLIAAQLP-GRTDNDGKNHWNT 197
                      689****************************.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-11131159IPR009057Homeodomain-like
SuperFamilySSF466892.18E-16133205IPR009057Homeodomain-like
PROSITE profilePS500904.077134147IPR017877Myb-like domain
PROSITE profilePS5129415.213148203IPR017930Myb domain
SMARTSM007170.0027152201IPR001005SANT/Myb domain
CDDcd001671.48E-4156199No hitNo description
Gene3DG3DSA:1.10.10.604.3E-12160200IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MMLGETHRAN PTVHVPPWTP EIFSPYTGNA DYSPYSLQEA LSALQHYEST DAESDSEFPS  60
REPEVPVDAY SCDHFRMFEF KVRRCARGRS HDWTECPYAH PGEKARRRDP RKYHYSGKNY  120
LNKHATPQKA GLKRCGKSCR LRWLNYLRPH IKHGDFTRQE DQLICTLYAT IGTMHVSLIA  180
AQLPGRTDND GKNHWNTKLN KTFLAANTNA IASTVFSTST SQPQLEDYSV FDDHENSAEY  240
LVLGLEQTPL PLGSDVFGLG SSCSVRLSNE AVSASLVKKE NENETQWFAE DESFLLDFVY  300
EDNGFVSQEN SSEVPPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1211820323108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN16664.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0986670.0BT098667.1 Soybean clone JCVI-FLGm-23G10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017441904.19e-82PREDICTED: myb-related protein 308-like
TrEMBLA0A445J9E51e-145A0A445J9E5_GLYSO; Transcription factor MYB87
STRINGGLYMA08G03525.11e-126(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29190.11e-46C3H family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]