PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN15916.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 276aa    MW: 30155.5 Da    PI: 9.175
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN15916.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.11.1e-392080262
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                ++++l+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknkk+s
  KHN15916.1 20 PQEQLNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKKVS 80
                6899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-271578IPR003851Zinc finger, Dof-type
PfamPF027011.4E-332278IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1242478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MEGMAPNSCA RPVVEKKARP QEQLNCPRCN STNTKFCYYN NYSLTQPRYF CKTCRRYWTE  60
GGSLRNVPVG GGSRKNKKVS VTASSSPKVP DLNPPNHSAI SSHNPKIMHG GQDLNLAFPA  120
MEKYHHHGMS PYNVEMQNSN TTTTHHHHQT SPSCSAPPAN SLSALELLRS SMASRGLNPY  180
APNSSLMPNS TNNNNNALYP SGFPMQEVKP SLNFSSVDGI GNNRSYDQER GGGRVLFPFG  240
DVKQLSAAAG AADQVEQQQQ GNSTGYWTGM IGEGTW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2209340.0KF220934.1 Glycine max cultivar Ilpumgeomjeong clone 2f2r Dof-type zinc finger DNA-binding family protein (Glyma16g02550) gene, partial cds.
GenBankKF2209320.0KF220932.1 Glycine max cultivar Pureun clone 2f2r Dof-type zinc finger DNA-binding family protein (Glyma16g02550) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006598895.10.0PREDICTED: dof zinc finger protein DOF2.5
RefseqXP_006598896.10.0PREDICTED: dof zinc finger protein DOF2.5
SwissprotQ433851e-62DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A0B2Q2V50.0A0A0B2Q2V5_GLYSO; Dof zinc finger protein DOF3.7
TrEMBLK7MET10.0K7MET1_SOYBN; Uncharacterized protein
STRINGGLYMA16G02550.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.49e-67Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]