PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN15871.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 749aa    MW: 82325.3 Da    PI: 6.1955
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN15871.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.2e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
       KHN15871.1 24 RERWTEEEHNRFLEALKLHGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-161874IPR009057Homeodomain-like
PROSITE profilePS5129420.2261973IPR017930Myb domain
TIGRFAMsTIGR015579.6E-162271IPR006447Myb domain, plants
SMARTSM007171.3E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-82364IPR009057Homeodomain-like
PfamPF002491.8E-132467IPR001005SANT/Myb domain
CDDcd001671.45E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 749 aa     Download sequence    Send to blast
MDAYSSGEEV VVKTRKPYTI TKQRERWTEE EHNRFLEALK LHGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEALVKG VPIGQALDID IPPPRPKRKP NNPYPRKTRI GTTSLHSGAK  120
DGKLNLVESS HVNQALDLKK EPLPEKHDLD EGLTTVKENK DENHAKVFTL LQEVPCSSVS  180
SANESSITMS VPLGNPCAFK EITPSVKEVI ARDEKTESFV TVEPENGKLE INDGKQTNGT  240
SKDSRLEDSD ALHMKLVQNE KPDGLDCELT IDGMQGNQNY PRHVTVHVVD GNLGTNTQNP  300
SQDMLFRDSM FQPIGGVNGQ RNVFTNTAPS NTSESQNNTA RSSVHQSFLP YPPFTQHNQD  360
DYQSFLHMSS TFSNLIVSTL MQNPAAHAAA SFAATFWPYA NPETSANSPR CSQGGFTNRQ  420
IGSPPSVAAI AAATVAAATA WWAAHGLLPL CAPLHTSFAC PASVTTVPSM NTGEAPALKA  480
EQEKTTLQNP PLQDQMLDPE YSEAQQAQHS ASKSPAAILS DSESGDAKLN TSSKVTDHET  540
NKTISEHLDS NKTKGRKPVD RSSCGSNTAS SSDVETDALE KGEKGKEEPE IPDANQLAIE  600
FSNRRRSVSN LTDSWKEVSE EGRLAFQALF SREVLPQSFS PPHALKNTDH QMDNANDNKQ  660
NIDDKDEDLD GKKCSSNYEA MQKNLLFVEN NEGLLTIGLG QGKLKTHRTG FKPYKRCSME  720
AKENRVGASS NQGEEQGCKR IRLEGETST
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN15871.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0764330.0EU076433.1 Glycine max late elongated hypocotyl and circadian clock associated-1-like protein 1 (LCL1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028206115.10.0protein LHY-like
RefseqXP_028206116.10.0protein LHY-like
RefseqXP_028206117.10.0protein LHY-like
RefseqXP_028206119.10.0protein LHY-like
RefseqXP_028206120.10.0protein LHY-like
RefseqXP_028206121.10.0protein LHY-like
RefseqXP_028206122.10.0protein LHY-like
RefseqXP_028206123.10.0protein LHY-like
TrEMBLC0SNP10.0C0SNP1_SOYBN; Late elongated hypocotyl and circadian clock associated-1-like protein 1
STRINGGLYMA16G01980.80.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-134MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]