PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN15671.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 752aa    MW: 82309.7 Da    PI: 5.9513
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN15671.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.91.3e-2154109156
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 +++ +++t++q++eLe++F+++++p++++r +L+k+lgL+ +qVk+WFqNrR+++k
  KHN15671.1  54 KKRYHRHTPHQIQELEAFFKECPHPDEKQRLDLSKRLGLENKQVKFWFQNRRTQMK 109
                 688999***********************************************999 PP

2START179.22.4e-562644872206
                 HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECT CS
       START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetleviss 87 
                 la++a++el+k+ +ae+p+W ks     e+ n +e+ + f++  +     + +ea r++g+v+ ++  lve+l+d + +W e+++    +a  l+vis+
  KHN15671.1 264 LALAAMEELLKMTQAESPLWIKSLdgekEIFNHEEYARLFSPCIGpkpagYVTEATRETGIVIINSLALVETLMDAN-RWAEMFPsmiaRAINLDVISN 361
                 6899********************99988999********99998********************************.*******99999999****** PP

                 T......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHH CS
       START  88 g......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphw 179
                 g      galq+m ae q+lsplvp R + f+R+++q+ +g+w++vdvS++   +  + ++++ +++lpSg+++++++ng+skvtw+eh++++++++h+
  KHN15671.1 362 GmggtrnGALQVMHAEVQLLSPLVPvRQVRFIRFCKQHAEGVWAVVDVSIEIGHDAANAQPSISCRRLPSGCIVQDMPNGYSKVTWLEHWEYDENVVHQ 460
                 ***************************************************9999999999************************************** PP

                 HHHHHHHHHHHHHHHHHHHHTXXXXXX CS
       START 180 llrslvksglaegaktwvatlqrqcek 206
                 l+r+l++sg+ +ga +w atlqrqce+
  KHN15671.1 461 LYRPLLSSGVGFGAHRWIATLQRQCEC 487
                 *************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-2238105IPR009057Homeodomain-like
SuperFamilySSF466891.88E-2040111IPR009057Homeodomain-like
PROSITE profilePS5007117.65351111IPR001356Homeobox domain
SMARTSM003891.1E-1952115IPR001356Homeobox domain
CDDcd000862.28E-1953111No hitNo description
PfamPF000462.9E-1954109IPR001356Homeobox domain
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PROSITE profilePS5084841.143254490IPR002913START domain
SuperFamilySSF559612.47E-31256487No hitNo description
CDDcd088751.51E-117258486No hitNo description
SMARTSM002344.3E-36263487IPR002913START domain
PfamPF018525.2E-47264487IPR002913START domain
SuperFamilySSF559614.07E-21515746No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MEGPSEIGLI GENFDAGLMG RMRDDEYESR SGSDNFEGAS GDDQDGGDDQ PQRKKRYHRH  60
TPHQIQELEA FFKECPHPDE KQRLDLSKRL GLENKQVKFW FQNRRTQMKT QLERHENIML  120
RQENDKLRAE NSLIKEAMSN PVCNNCGGPA IPGQISFEEH QIRIENARLK DELNRICVLA  180
NKFLGKPISS LTSPMALTTS NSGLELGIGR NGIGGSSTLG TPLPMGLDLG DGVLGTQPAM  240
PGVRSALGLM GNEVQLERSM LIDLALAAME ELLKMTQAES PLWIKSLDGE KEIFNHEEYA  300
RLFSPCIGPK PAGYVTEATR ETGIVIINSL ALVETLMDAN RWAEMFPSMI ARAINLDVIS  360
NGMGGTRNGA LQVMHAEVQL LSPLVPVRQV RFIRFCKQHA EGVWAVVDVS IEIGHDAANA  420
QPSISCRRLP SGCIVQDMPN GYSKVTWLEH WEYDENVVHQ LYRPLLSSGV GFGAHRWIAT  480
LQRQCECLAI LMSSSISSDS HTALSQAGRR SMLKLAQRMT SNFCSGVCAS SARKWDSLHI  540
GTLGDDMKVM TRKNVDDPGE PPGIVLSAAT SVWMPVSRQR LFDFLRDERL RSEWDILSNG  600
GPMQEMVHIA KGQGHGNCVS LLRANAVNAN DSSMLILQET WMDASCSVVV YAPVDVQSLN  660
VVMSGGDSAY VALLPSGFAI LPDGHCNDNG CNGSLQKGRG SDDGSGGSLL TVGFQILVNS  720
LPTAKLTVES VDTVNNLISC TIQKIKAALR VA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN15671.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006606096.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLI1NGR20.0I1NGR2_SOYBN; Uncharacterized protein
STRINGGLYMA20G29580.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]