PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN15561.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 631aa    MW: 69896.3 Da    PI: 5.8666
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN15561.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS192.23.3e-593195011191
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 lv+lLl+cAeav++++  la+++L +l+  ++p gd+mqR+aa+ft  L+arl++ + +   a p+++ +++ns e+l+++++ ++++P++kf+h+taN
  KHN15561.1 319 LVHLLLACAEAVAKEEYMLARRYLHHLNRVVTPLGDSMQRVAACFTDSLSARLNS-TLTPKPATPSKPLTPSNSLEVLKIYQIVYQACPYVKFAHFTAN 416
                 68****************************************************9.44444566888999999************************** PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                 qaI ea+e+e+  H+iD+di qG QWpa++qaLa+Rp+g+p lRiTgvg+      ++++etg+ L+++A++l++pfef++ v ++ledl++
  KHN15561.1 417 QAIFEAFETED--HVIDLDILQGYQWPAFMQALAARPAGAPFLRITGVGP----LLDAVRETGRCLTELAHSLRIPFEFHA-VGEQLEDLKP 501
                 *********99..9************************************....99*************************.7999999987 PP

2GRAS161.66.5e-50504630248374
        GRAS 248 hnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                 hn++ Fl rfleal+yysa+fdsl+a++p+es +r+kvE+ ++++ei+n+vacegaer+erhe+lekWr+ +e  GFk v+ls +a++q k ll  ++ 
  KHN15561.1 504 HNGPYFLGRFLEALHYYSAIFDSLDATFPAESAQRAKVEQYIFAPEIRNIVACEGAERFERHERLEKWRKIMEGKGFKGVALSPNAVTQSKILLGLYSC 602
                 7999*********************************************************************************************** PP

        GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaWr 374
                 +gyr+ e++g+l+lgW+dr+++++SaWr
  KHN15561.1 603 EGYRLTEDKGCLLLGWQDRAIIAASAWR 630
                 ***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098533.725293631IPR005202Transcription factor GRAS
PfamPF035141.2E-56319501IPR005202Transcription factor GRAS
PfamPF035142.3E-47504630IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 631 aa     Download sequence    Send to blast
MMNSLCGSSL SLKSENNNSR TKLQQPTSSN DSVLQSKKNN ATQSSGDLDQ TSLTPPSLNL  60
PSLKFDLDGD VEVQSPDSSM WESFFADHID GDFMISSPVR TPQAASSYNC NYNYAQGMQG  120
QSLSGCSPPR FSSSQIGAFN SSSSLNKGKG LSPLHRVFNS PNNQYMQHVE NLSLPAIEEF  180
LEDYQTKVSS SDHNITSSSE CFDLSSHQIP SSILDGLALH NSSRYHRGSV VDEESTVHGG  240
GGGGGGSSQL SQESDIYHQM GSMASASLSQ ALQQERYQEK QQKQQAQQLQ QQQRQHQQEN  300
LMVPIPIEIE QEQDSGLQLV HLLLACAEAV AKEEYMLARR YLHHLNRVVT PLGDSMQRVA  360
ACFTDSLSAR LNSTLTPKPA TPSKPLTPSN SLEVLKIYQI VYQACPYVKF AHFTANQAIF  420
EAFETEDHVI DLDILQGYQW PAFMQALAAR PAGAPFLRIT GVGPLLDAVR ETGRCLTELA  480
HSLRIPFEFH AVGEQLEDLK PHIHNGPYFL GRFLEALHYY SAIFDSLDAT FPAESAQRAK  540
VEQYIFAPEI RNIVACEGAE RFERHERLEK WRKIMEGKGF KGVALSPNAV TQSKILLGLY  600
SCEGYRLTED KGCLLLGWQD RAIIAASAWR C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-423196304375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2358640.0AC235864.2 Glycine max clone GM_WBb0106P01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553957.10.0PREDICTED: DELLA protein GAI-like
TrEMBLA0A0B2Q1T70.0A0A0B2Q1T7_GLYSO; Protein SCARECROW
STRINGGLYMA19G26735.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF94703243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.13e-81GRAS family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]