PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN15202.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 549aa    MW: 60079.6 Da    PI: 7.0024
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN15202.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1352.4e-42172247277
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 Cqv gC++dls++k+yh+rhkvCevhsk++ v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  KHN15202.1 172 CQVYGCNKDLSSCKDYHKRHKVCEVHSKTAIVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 247
                 **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.1E-33166233IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.539169246IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-39170249IPR004333Transcription factor, SBP-box
PfamPF031102.5E-31172245IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MESWSYVPEE KECVSNEALS PPNTLGRSKN SFLGWELKTP CGFSNDMLGL GHHSIENQGF  60
EELGFPEMLG KHMSDDLIGS VPTRKVNGNR QQQHSDRITG TVVDAPSGFS QRGDSNSKLS  120
NSNSLIDLKL GRFADHGDFT DRAFSKVLSS SESSTPPKRV RASGLHSQTA YCQVYGCNKD  180
LSSCKDYHKR HKVCEVHSKT AIVIVNGIEQ RFCQQCSRFH LLAEFDDGKR SCRKRLAGHN  240
ERRRKPQMGI HPGKSGRLLQ PCGDSRFQGS MLTSSFICPE MLPSGVTCSE KYGMSDFWRP  300
IKAEHGTGFR NLSSMAATNG HPPSRSLFPS YNGNQFPFLH ENSATSTTGS IFCESNSPYP  360
SALGAQNSGL RPLFQDTVGN ENFNVFDTSS TVQGLSGISD SCCALSLLSS QSQNSSSQSS  420
GIPLAHSLVI PSSHSHHYNM SQVSEKIGIS SQTSSSRVSD SFPSELNHAD GSHLSPVLIS  480
DNNCIVNFDM ADGIFQASDY LNVKDHLSGE DGATIDLLQL SSQLQRVEHE RQSLQVKQEN  540
DSSCTLRIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281722451184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN15202.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2209620.0KF220962.1 Glycine max cultivar Williams 82K clone 3f5r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209630.0KF220963.1 Glycine max cultivar Sowon clone 3f5r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209640.0KF220964.1 Glycine max cultivar Pureun clone 3f5r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209650.0KF220965.1 Glycine max cultivar Kwangkyo clone 3f5r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209660.0KF220966.1 Glycine max cultivar Ilpumgeomjeong clone 3f5r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209670.0KF220967.1 Glycine max cultivar Seoritae clone 3f5r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209680.0KF220968.1 Glycine max cultivar PI96983 clone 3f5r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209690.0KF220969.1 Glycine max cultivar Haman clone 3f5r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209700.0KF220970.1 Glycine max cultivar Geomjeongol clone 3f5r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209710.0KF220971.1 Glycine max cultivar Hwangkeum clone 3f5r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209730.0KF220973.1 Glycine soja cultivar IT178480 clone 3f5r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209750.0KF220975.1 Glycine soja cultivar IT182840 clone 3f5r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
GenBankKF2209760.0KF220976.1 Glycine soja cultivar IT182848 clone 3f5r squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (Glyma17g08840) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006579490.10.0squamosa promoter-binding-like protein 6 isoform X1
RefseqXP_028231279.10.0squamosa promoter-binding-like protein 6 isoform X1
RefseqXP_028231280.10.0squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A445KIY40.0A0A445KIY4_GLYSO; Squamosa promoter-binding-like protein 6 isoform A
TrEMBLK7K0P90.0K7K0P9_SOYBN; Uncharacterized protein
STRINGGLYMA0005S50.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-53SBP family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]