PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN15080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family YABBY
Protein Properties Length: 186aa    MW: 20930.9 Da    PI: 8.1615
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN15080.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY2014.7e-6261593170
       YABBY   3 vfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvssekl 101
                 ++ ++eq+Cy+ CnfCn +lavsvP +slf +vtvrCGhCt+l svn+a a q l+ ++    ++  +   e + +          + s+s+ ++   +
  KHN15080.1   6 IDVAPEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQDV---QGPGQCNPEYRID----------TGSTSKCNNRIAM 91 
                 66789********************************************99999998884...2222222222222..........2222222222222 PP

       YABBY 102 senedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                     + +v++   v+rPPekrqrvPsayn+fikeeiqrika+nPdishreafs+aaknWahfP+ihfgl
  KHN15080.1  92 RA-PTTHVTEERVVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL 159
                 22.233344445689****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046909.5E-709159IPR006780YABBY protein
SuperFamilySSF470954.19E-8103152IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.3E-4107153IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MSSCSIDVAP EQLCYIPCNF CNIVLAVSVP CSSLFDIVTV RCGHCTNLWS VNMAAAFQSL  60
SWQDVQGPGQ CNPEYRIDTG STSKCNNRIA MRAPTTHVTE ERVVNRPPEK RQRVPSAYNQ  120
FIKEEIQRIK ANNPDISHRE AFSTAAKNWA HFPHIHFGLM LESNNQAKMD NVSEKHLMPR  180
AALLNK
Functional Description ? help Back to Top
Source Description
UniProtPromotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN15080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0902160.0BT090216.1 Soybean clone JCVI-FLGm-3N14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001238347.11e-139protein YABBY 15
RefseqXP_028209579.11e-139axial regulator YABBY 5-like isoform X1
SwissprotQ8GW461e-89YAB5_ARATH; Axial regulator YABBY 5
TrEMBLA0A445G5F51e-138A0A445G5F5_GLYSO; Axial regulator YABBY 5
TrEMBLC6SYG81e-138C6SYG8_SOYBN; Uncharacterized protein
STRINGGLYMA17G12200.11e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112434112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.25e-92YABBY family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC
    The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity.
    Plant Cell, 2015. 27(12): p. 3321-35
    [PMID:26589551]