PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN14146.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 433aa    MW: 48827.8 Da    PI: 9.9857
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN14146.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.61.2e-07128170346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT+eE ++l d+++++  + +  Ia +++  Rt +++k+r+++
       KHN14146.1 128 TWTKEETDQLFDLCERFDLR-FIVIADRFPSSRTVEELKDRYYS 170
                      7*******************.*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162823.8E-31101175IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007174.2E-8125174IPR001005SANT/Myb domain
SuperFamilySSF466891.79E-6126172IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-6128172IPR009057Homeodomain-like
CDDcd116582.97E-19129171No hitNo description
PfamPF054994.3E-6308370IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MDAKDILGLP KNSFPSLEKK SRPPKESQRK PDGISREVYA LTGGLASLMP AIEASQLKKK  60
PLPLEKITWQ WLPFTSSARK DNLHLYHWVR VINGVPPTGD YSFAKYNKSV DVIKYTDEEY  120
DKYLSDPTWT KEETDQLFDL CERFDLRFIV IADRFPSSRT VEELKDRYYS VSRAILIARA  180
PSSGDVVAHS IVKEPYNVAQ EMERKRALSM VLSQTRQQER RDEEVLVEAK KIAEKRLPPK  240
VAGQSQFVAS NAGAEAIERA VPGETVSPSN VQLPMVAPDN ASTLASLRML RVYLRTYALE  300
QMVQAGNASA GLRTIKRIEQ TLQDLGVNLK PRVPTKAVCA EHLELRKEIL TWLNLQKQVQ  360
YKEAEGSSFR DGSYGETPGT PKHLHRGGDQ DRTFIPDSMN FGVERVGKKD QKRKAPGAPS  420
AHKRPRKLKA SDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A3e-21100185493DNA methyltransferase 1-associated protein 1
4iej_A3e-21100185493DNA methyltransferase 1-associated protein 1
Search in ModeBase