PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN13705.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 420aa    MW: 47669.3 Da    PI: 6.7085
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN13705.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS381.51e-11634164373
        GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                 lLl+cA++v+sg+ ++a+  L+ +s+++spdg+++qR+++yf eAL+ r+ +  +++yk+l+p +ts   sse + ++k+f++++P+lkfs+l++NqaI
  KHN13705.1   3 LLLDCAKCVASGSIKNADIGLEYISQISSPDGSAVQRMVTYFSEALSYRIIKRLPGVYKSLNPPKTS--LSSEDILVQKYFYDLCPFLKFSYLITNQAI 99 
                 79***********************************************************999887..69**************************** PP

        GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEa 201
                 +ea+e e+ vHiiD+   +++QW+ Ll ++ +R++gpp+l+iTg+++    +ke l +++  L+  A +l+ p++f + v ++led+++e+L vk g+a
  KHN13705.1 100 VEAMEFEKVVHIIDLHCCEPAQWIDLLLTFKNRQGGPPHLKITGIHE----KKEVLDQMNFHLTTEAGKLDFPLQFYP-VISKLEDVDFEKLPVKIGDA 193
                 ***********************************************....9**************************.7999**************** PP

        GRAS 202 laVnlvlqlhrll........................................................desvsleserdevLklvkslsPkvvvvveq 244
                 la+++vlqlh+ll                                                          s +       +L+++++l+Pk+vv++eq
  KHN13705.1 194 LAISSVLQLHSLLatdddmagrispaaaatmnlqravhmgqrtfaewlerdminayilspdsalsplslGASPK----MGIFLNAMQKLQPKLVVITEQ 288
                 ************************************************************99977644444444....566****************** PP

        GRAS 245 eadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                 e+++n+++++er+ +al++ysalfd+le+++ r+s er+k+E +llg++i+n++aceg +r+erhe+lekW +rle+aGF +vpls++   +ak ll++
  KHN13705.1 289 ESNLNGSNLMERVDRALYFYSALFDCLESTVLRTSVERQKLESMLLGEQIKNIIACEGVDRKERHEKLEKWIRRLEMAGFVKVPLSYNGRIEAKNLLQR 387
                 *************************************************************************************************** PP

        GRAS 344 vksdgyrveeesgslvlgWkdrpLvsvSaW 373
                 ++++ y+  ee+++l+ +W+d p++svSaW
  KHN13705.1 388 YSNK-YKFREENDCLLVCWSDTPMFSVSAW 416
                 **66.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.2331398IPR005202Transcription factor GRAS
PfamPF035143.6E-1143416IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MILLLDCAKC VASGSIKNAD IGLEYISQIS SPDGSAVQRM VTYFSEALSY RIIKRLPGVY  60
KSLNPPKTSL SSEDILVQKY FYDLCPFLKF SYLITNQAIV EAMEFEKVVH IIDLHCCEPA  120
QWIDLLLTFK NRQGGPPHLK ITGIHEKKEV LDQMNFHLTT EAGKLDFPLQ FYPVISKLED  180
VDFEKLPVKI GDALAISSVL QLHSLLATDD DMAGRISPAA AATMNLQRAV HMGQRTFAEW  240
LERDMINAYI LSPDSALSPL SLGASPKMGI FLNAMQKLQP KLVVITEQES NLNGSNLMER  300
VDRALYFYSA LFDCLESTVL RTSVERQKLE SMLLGEQIKN IIACEGVDRK ERHEKLEKWI  360
RRLEMAGFVK VPLSYNGRIE AKNLLQRYSN KYKFREENDC LLVCWSDTPM FSVSAWSFSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-3744168374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539220.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR81e-148SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A0B2PX660.0A0A0B2PX66_GLYSO; Scarecrow-like protein 3
STRINGGLYMA11G20980.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF145191017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-147scarecrow-like 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]