PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN13232.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 291aa    MW: 33146.1 Da    PI: 7.7492
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN13232.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.5e-1992145356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k+ ++++eq++ Le+ Fe  +++  e++ +LAk lgL+ rq+++WFqNrRa++k
  KHN13232.1  92 KKKRLSQEQVKGLEKSFELGNKLEPERKMQLAKALGLQPRQISIWFQNRRARWK 145
                 45679************************************************9 PP

2HD-ZIP_I/II126.51.2e-4091183193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekk+rls+eqvk LE+sFe  +kLeperK++la++Lglqprq+ +WFqnrRAR+ktkqlEk+ye+Lk+ ++a+k++n++L++++++L++el++
   KHN13232.1  91 EKKKRLSQEQVKGLEKSFELGNKLEPERKMQLAKALGLQPRQISIWFQNRRARWKTKQLEKEYEVLKKLFEAVKADNDSLKAQNQKLHAELQT 183
                  69***************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.2E-1890151IPR001356Homeobox domain
SuperFamilySSF466895.13E-1991149IPR009057Homeodomain-like
PROSITE profilePS5007116.81191147IPR001356Homeobox domain
CDDcd000862.06E-1592148No hitNo description
PfamPF000465.4E-1692145IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-1994154IPR009057Homeodomain-like
PRINTSPR000317.6E-6118127IPR000047Helix-turn-helix motif
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PRINTSPR000317.6E-6127143IPR000047Helix-turn-helix motif
PfamPF021836.6E-14147186IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MAFPPSHTFM FQTHEDHDPH QLHLRSTSTS LNAFPSFPPH HFQGGGAGAG GFMMKRSMSF  60
SSIEKNNHKN KCDEVHGDDE LSDEGSQLLG EKKKRLSQEQ VKGLEKSFEL GNKLEPERKM  120
QLAKALGLQP RQISIWFQNR RARWKTKQLE KEYEVLKKLF EAVKADNDSL KAQNQKLHAE  180
LQTLKSRDCS ETGTVISLKK ETEGSWSNGS NNSSEINLDL SRTPVMNSPV SSSLNGKTLL  240
PTSLKPTSIT QLLQCSSRSD LQDESFCNMF HNIDEQQNFW PWPDHQQHQF H
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN13232.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0956290.0BT095629.1 Soybean clone JCVI-FLGm-19L17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003543764.10.0homeobox-leucine zipper protein HAT7 isoform X1
RefseqXP_028196309.10.0homeobox-leucine zipper protein HAT7-like isoform X1
SwissprotQ004667e-79HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLI1LWJ50.0I1LWJ5_SOYBN; Uncharacterized protein
STRINGGLYMA13G05270.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.14e-72homeobox 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]