PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN13125.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 424aa    MW: 47046.6 Da    PI: 6.5141
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN13125.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.89e-32257311155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k+r+rWt+eLHe+Fve+v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  KHN13125.1 257 KTRIRWTQELHEKFVECVNRLGGAEKATPKAILRLMDSDGLTIFHVKSHLQKYRI 311
                 68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.617254314IPR017930Myb domain
SuperFamilySSF466892.69E-17255311IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28255312IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-23257312IPR006447Myb domain, plants
PfamPF002491.0E-8261310IPR001005SANT/Myb domain
PfamPF143796.5E-21341387IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MNENRIDSCV GRIQQSYGLN GDWNSEFGNC SSQYFDMRQA SNMGTSNQPL AMASGGGVEQ  60
EPNIGQTKSS SSIISRFESP ASAFYATEMC MGGFPQYDSQ IGNNLSLMSQ SSKFSNMEFP  120
LYQSPRQSLF MASLANQPPP NFDLSNPLQE ILKSHLNSDQ CVRSPEDSNK IPYGDFPGSN  180
FLPIEQHKFF IDDAISTGIS PSIPSKGNQD QSVSCGPFNL PSAQLSFSSQ QEMLSPTGSM  240
STTSGNSNSN GPVVSSKTRI RWTQELHEKF VECVNRLGGA EKATPKAILR LMDSDGLTIF  300
HVKSHLQKYR IAKFMPQPTQ GKSDKRTNVE NVHLDVKTGL QIKEALQLQL DVQRRLHEQL  360
EIQRKLQLRI EEQGKQLKMM FDQQQKTSNG HLITENNDRP ISSKDVLVST SDGSENSLFS  420
TNIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2361410.0AC236141.2 Glycine max clone GM_WBb0004A16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006587215.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
TrEMBLA0A0B2PVD60.0A0A0B2PVD6_GLYSO; Myb family transcription factor APL
TrEMBLK7LD830.0K7LD83_SOYBN; Uncharacterized protein
STRINGGLYMA09G17404.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.13e-69G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]