PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN12936.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 306aa    MW: 34096.7 Da    PI: 9.9989
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN12936.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.72.4e-125599147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
       KHN12936.1 55 RESWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 99
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.92E-1649105IPR009057Homeodomain-like
PROSITE profilePS5129414.1850104IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-653105IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-1853102IPR006447Myb domain, plants
SMARTSM007176.5E-1054102IPR001005SANT/Myb domain
PfamPF002494.4E-105599IPR001005SANT/Myb domain
CDDcd001671.12E-757100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MVSKNPNPSE AFYLDPSGMS LPGILPFAAA ATATADSFED PAKKTRKPYT ITKSRESWTE  60
PEHDKFLEAL QLFDRDWKKI EAFVGSKTVI QIRSHAQKYF LKVQKSGTNE HLPPPRPKRK  120
AAHPYPQKAS KTAPVLSQVS GSFQSSSALL EPGYILKHDS SAMPKTPIIN TAVSSWSNNS  180
LQKTTSVLHG QKQKVNNCCS SSRSPRAQLV GESNGQRNNS HPLRGKVLPD FAEVYSFIGS  240
VFDPNVTGHV QKLKRMDPID VETVLLLMRN LSINLASPDF EDHRRLLASY EVEPEVDKYK  300
CRLNHA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00560DAPTransfer from AT5G52660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN12936.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556126.10.0protein REVEILLE 6 isoform X3
SwissprotQ8H0W31e-117RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A0B2PUC40.0A0A0B2PUC4_GLYSO; Transcription factor ASG4
STRINGGLYMA20G30250.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.12e-96MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  3. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]