PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN12903.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 88aa    MW: 10053.7 Da    PI: 9.3621
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN12903.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEd++l d++++ G g+Wk  ++  g+ R++k+c++rw +yl
       KHN12903.1 14 KGRWTAEEDKILTDYIQENGEGSWKILPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-22564IPR009057Homeodomain-like
PROSITE profilePS5129420.439965IPR017930Myb domain
SMARTSM007179.1E-121363IPR001005SANT/Myb domain
PfamPF002491.9E-151461IPR001005SANT/Myb domain
SuperFamilySSF466894.9E-221588IPR009057Homeodomain-like
CDDcd001674.51E-91661No hitNo description
Gene3DG3DSA:1.10.10.603.8E-86588IPR009057Homeodomain-like
PROSITE profilePS512948.896688IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MGRSPCCEKV GLKKGRWTAE EDKILTDYIQ ENGEGSWKIL PKNAGLLRCG KSCRLRWINY  60
LRADVKRGNI TPEEEEIIVK LHAVLGNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-131288580B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtFlavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis mainly in the root (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:15923334, ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}.
UniProtModulates overall growth by reducing the proliferation activity of meristematic cells and delaying development (PubMed:18359753). Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1 (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:18359753, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00668SELEXTransfer from GRMZM2G016020Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN12903.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By nitrogen deficiency, sucrose and UV LIGHT (PubMed:17053893, PubMed:9839469). Triggered by HY5 in response to light and UV-B (PubMed:19895401). {ECO:0000269|PubMed:17053893, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1915994e-33AC191599.4 Medicago truncatula chromosome 2 BAC clone mth2-181i5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533213.12e-56transcription factor MYB13
RefseqXP_028180329.12e-56transcription factor MYB13-like
SwissprotO222643e-49MYB12_ARATH; Transcription factor MYB12
SwissprotQ9LZK42e-49MYB11_ARATH; Transcription factor MYB11
TrEMBLA0A0B2PYR34e-57A0A0B2PYR3_GLYSO; Transcription factor MYB12
STRINGGLYMA09G04370.17e-56(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62610.17e-52myb domain protein 11
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pandey A, et al.
    Co-expression of Arabidopsis transcription factor, AtMYB12, and soybean isoflavone synthase, GmIFS1, genes in tobacco leads to enhanced biosynthesis of isoflavones and flavonols resulting in osteoprotective activity.
    Plant Biotechnol. J., 2014. 12(1): p. 69-80
    [PMID:24102754]
  3. Schenke D,Cai D,Scheel D
    Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification.
    Plant Cell Environ., 2014. 37(7): p. 1716-21
    [PMID:24450952]
  4. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  5. Huang BH, et al.
    Positive selection and functional divergence of R2R3-MYB paralogous genes expressed in inflorescence buds of Scutellaria species (Labiatae).
    Int J Mol Sci, 2015. 16(3): p. 5900-21
    [PMID:25782156]
  6. Pandey A, et al.
    AtMYB12 expression in tomato leads to large scale differential modulation in transcriptome and flavonoid content in leaf and fruit tissues.
    Sci Rep, 2015. 5: p. 12412
    [PMID:26206248]
  7. Lotkowska ME, et al.
    The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress.
    Plant Physiol., 2015. 169(3): p. 1862-80
    [PMID:26378103]
  8. Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
    The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors.
    Plant Physiol. Biochem., 2016. 102: p. 70-9
    [PMID:26913794]
  9. Li Y, et al.
    Development of Marker-Free Transgenic Potato Tubers Enriched in Caffeoylquinic Acids and Flavonols.
    J. Agric. Food Chem., 2016. 64(14): p. 2932-40
    [PMID:27019017]
  10. Zhou Z,Schenke D,Miao Y,Cai D
    Investigation of the crosstalk between the flg22 and the UV-B-induced flavonol pathway in Arabidopsis thaliana seedlings.
    Plant Cell Environ., 2017. 40(3): p. 453-458
    [PMID:28032363]
  11. Wang N, et al.
    MYB12 and MYB22 play essential roles in proanthocyanidin and flavonol synthesis in red-fleshed apple (Malus sieversii f. niedzwetzkyana).
    Plant J., 2017. 90(2): p. 276-292
    [PMID:28107780]
  12. Stracke R,Turgut-Kara N,Weisshaar B
    The AtMYB12 activation domain maps to a short C-terminal region of the transcription factor.
    Z. Naturforsch., C, J. Biosci., 2017. 72(7-8): p. 251-257
    [PMID:28284041]
  13. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]
  14. Camargo-Ramírez R,Val-Torregrosa B,San Segundo B
    MiR858-Mediated Regulation of Flavonoid-Specific MYB Transcription Factor Genes Controls Resistance to Pathogen Infection in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 190-204
    [PMID:29149328]
  15. Hidalgo D, et al.
    Tailoring tobacco hairy root metabolism for the production of stilbenes.
    Sci Rep, 2017. 7(1): p. 17976
    [PMID:29269790]