PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN12878.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 595aa    MW: 67676.5 Da    PI: 4.7455
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN12878.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS295.71.2e-902245932374
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn.sseelaalkl..fsevsPilkfshl 96 
                  e Ll+cAe v ++++e+a++lL+r + l+ ++g+p++R+++yf+eAL++r+ r ++   yk l+  ++ +    +++l+ + +  f+e  P+ ++s +
  KHN12878.1 224 AESLLACAEKVGHQQFERASKLLSRCESLSCKTGSPVRRIVHYFAEALRQRIDRaTGRVSYKDLQKGPSFDPLeATKVLNPT-VvaFYEELPFCQISVF 321
                 578***************************************************5555566777555544333133333333.257************* PP

        GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                 t  q I e v++++++H+iD++i +G+QW  L+qaL sR e p   l+iT+v+s +   ++  e tgerL+++A+ l++pf++n+++++++  l  + +
  KHN12878.1 322 TEVQVIIEDVAEAKKIHVIDLEIRKGVQWTILMQALESRHECPIeLLKITAVESGT--TRHIAEDTGERLKDYAQGLNIPFSYNIVMVSDMLHLGEDVF 418
                 ****************************************7665499*******44..89999************************************ PP

        GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                 +++p+E+++V ++++l +  +es++le     ++++++ l+P v+vv+e ea+hns+sF++rf+eal ++s++fd+le+ +  ++ +r+ vE  +++  
  KHN12878.1 419 EIDPEETIVVYSHFALRTKIQESGQLEI----MMRVIRILNPSVMVVAEIEANHNSTSFVNRFIEALFFFSTFFDCLETCMKGDEGNRMIVESLYFSHG 513
                 ****************************....******************************************************************* PP

        GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 i+n+va+egaer  r  +   Wr+ ++++G+ + +ls+    qa+l+ ++++s   + +++ ++l++gWk+ p+ svS+W+
  KHN12878.1 514 IRNIVAAEGAERDSRSVKIDVWRAFFSRFGMVEKELSKLCLFQADLVAKRFPSY-STFDKNGHCLLIGWKGTPINSVSVWK 593
                 ****************************************************55.8999999******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.046197574IPR005202Transcription factor GRAS
PfamPF035144.1E-88224593IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MEDLYHVSFT TDDNSSSSND ILWCTEELNE LRKVQFSGAE DHGEYGGIDP LYSNFGFFPD  60
DPSEQEGYLL STDQQKYHQQ VQPSYHDYGQ LDDNLQFDMV SLPLQFDAQY PTMVPLCHTT  120
KDKPNSNSNT PLASLDILNN YGKGFKRLRN EDKTLKQVDD VAMATTNEGI MRKLSTEDVM  180
RIAGTRFIQS SSSESESLPF LETHPFGIYF SGLSNEEKED VELAESLLAC AEKVGHQQFE  240
RASKLLSRCE SLSCKTGSPV RRIVHYFAEA LRQRIDRATG RVSYKDLQKG PSFDPLEATK  300
VLNPTVVAFY EELPFCQISV FTEVQVIIED VAEAKKIHVI DLEIRKGVQW TILMQALESR  360
HECPIELLKI TAVESGTTRH IAEDTGERLK DYAQGLNIPF SYNIVMVSDM LHLGEDVFEI  420
DPEETIVVYS HFALRTKIQE SGQLEIMMRV IRILNPSVMV VAEIEANHNS TSFVNRFIEA  480
LFFFSTFFDC LETCMKGDEG NRMIVESLYF SHGIRNIVAA EGAERDSRSV KIDVWRAFFS  540
RFGMVEKELS KLCLFQADLV AKRFPSYSTF DKNGHCLLIG WKGTPINSVS VWKFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-382255936375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003534817.10.0PREDICTED: DELLA protein RGL2-like
TrEMBLA0A0B2PYP40.0A0A0B2PYP4_GLYSO; DELLA protein RGL2
STRINGGLYMA09G04110.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-56RGA-like 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]