PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN12343.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 393aa    MW: 44810.6 Da    PI: 6.1244
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN12343.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding409.3e-13109153247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      + WT eE+ +++ a  + G+g+W tI++++g +++  q+ s+ qky
       KHN12343.1 109 LQWTVEEHMKFLVALDEVGKGDWITISKHIG-TKSSTQVASHAQKY 153
                      57*****************************.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-7101161IPR009057Homeodomain-like
PROSITE profilePS5129414.004103158IPR017930Myb domain
SuperFamilySSF466891.56E-13105158IPR009057Homeodomain-like
SMARTSM007173.7E-7107156IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.5E-11108157IPR006447Myb domain, plants
PfamPF002491.1E-10110153IPR001005SANT/Myb domain
CDDcd001673.85E-8111153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MSGFSQQHNN VDNNGGTSSL SDDEDDLTRF FDYDTAPGQN LDELFAPSIV TQLPPMLPAE  60
ATQHHHTLPQ HVNQIVSSSP VDLPSHVPIE ALVQQNGGSS VQRQRGKGLQ WTVEEHMKFL  120
VALDEVGKGD WITISKHIGT KSSTQVASHA QKYYLRQKAK KKIRKSIHDI TLNTISHQDD  180
TQNSTPHPDP EIQPVHEIHQ MQEMPPNSMT HQMSGFEYFA NQQVHEIQQM QDILSVYPSN  240
NITHQMGGFE HFVNQQVHEM PVYPPNNMTH QMSGFEHFAN QQVHEMQQMQ DILSMYPSNN  300
MIHQMNGSEY FVNQQVHEMP VHPPNNMTHQ MSGFKYFANQ QVHEMQQMQD ILPAYSSNNM  360
THQISGFECS NKDFGRGCYK SEYPPNNTSS PNN
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN12343.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6238540.0EF623854.1 Glycine max cultivar Williams 82 clone BAC 77G7-a, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A445JCZ80.0A0A445JCZ8_GLYSO; Transcription factor KUA1
STRINGGLYMA08G11541.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3564622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05790.16e-22MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]