PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN12303.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARF
Protein Properties Length: 1125aa    MW: 125875 Da    PI: 6.4356
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN12303.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.61e-22126227199
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                 f+k+lt sd++++g +++p++ ae++       + +++  ++++ +d++ ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   ++++++l
  KHN12303.1 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QEIVAKDLHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI--RDEKQQL 220
                 99*****************************954.4444.48************************************************..5578888 PP

                 EEEEE-S CS
          B3  93 vvkvfrk 99 
                 ++++ r+
  KHN12303.1 221 LLGIKRA 227
                 9988775 PP

2Auxin_resp121.85.2e-40252334183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aahaas++s+F+++YnPras+seFv++++k++kal ++vs+GmRf+m+fete+s  rr++Gt++g++dldpvrW+nS+Wr+L+
  KHN12303.1 252 AAHAASNNSPFTIFYNPRASPSEFVIPLAKYNKALFNQVSLGMRFRMMFETEESGVRRYMGTITGITDLDPVRWKNSQWRNLQ 334
                 79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.96E-44116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-41118241IPR015300DNA-binding pseudobarrel domain
CDDcd100178.85E-20125217No hitNo description
SMARTSM010191.7E-23126228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.182126228IPR003340B3 DNA binding domain
PfamPF023624.8E-21126227IPR003340B3 DNA binding domain
PfamPF065074.6E-35252334IPR010525Auxin response factor
PfamPF023096.8E-109951085IPR033389AUX/IAA domain
PROSITE profilePS5174524.6559981091IPR000270PB1 domain
SuperFamilySSF542771.5E-810121076No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1125 aa     Download sequence    Send to blast
MKAPPNGYLP NSGEGERKTI NSELWHACAG PLVSLPPVGS VVVYFPQGHS EQVAASMQKE  60
ADFIPSYPNL PSKLICMLHN VALHADPETD EVYAQMTLQP VNKYDKEALL ASDMGLKQNQ  120
QPTEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQEIVAKD LHDNTWTFRH  180
IYRGQPKRHL LTTGWSVFVS TKRLFAGDSV LFIRDEKQQL LLGIKRANRQ QPALSSSVIS  240
SDSMHIGILA AAAHAASNNS PFTIFYNPRA SPSEFVIPLA KYNKALFNQV SLGMRFRMMF  300
ETEESGVRRY MGTITGITDL DPVRWKNSQW RNLQVGWDES TAGERPSRVS IWDIEPVVTP  360
FYICPPPFFR PKFPKQPGMP DDESDIENAF KRAMPWLGDD LGMKDASSSV FPGFSLMQWM  420
SMQQNNQFSA AQSGFIPPSM LSSNALHGNL TTDDPSKLLS FQAPVLSSPN LQFNKPNLAN  480
QVNQLQQSPT SWSPQQQQQQ QQQKLQSMLQ TPLNPLQQQR QQQLPVPQNL PQPQQQQPQM  540
PQQRAQQPQE QQQQSCQQTI MNNGAVASNQ IPNQCVQQPV SYSQLQQQQL ISGSIPPQQC  600
FPSPNKNTLL MTSLPQDSQF QQQIDQQASL LQRQQLQQQQ QQTQLQSSPL QLLQQSLSQR  660
APQQPQMTQM SQQNSSDQQP QLQMLQKLQQ QQQQQQQQQQ QKPLSTSSPL LQSQLLQQQN  720
THQQNQQFPQ LPLSQGHQPQ QLGNNAFSME KLLNGNNYSS SSLMQTQQLS VNQPHNTQKS  780
LTNTRAPSTL TDGDAPSCST SPSTNNCQIS PNLMKRNQQV SATLGGPSVV EPTNHLMQEL  840
HSKSEMQIKH ELPSVRGTDQ LKFKGTVADQ MEASSGTSYC IDPNNIHQNF PLPNFCMDGD  900
VQSHPRNNFP FASNLDGLTP DTLLSRGYDS QKDFQNLLSN YGGAPRDIET ELSTAALSPQ  960
PFGVPDMPFK PGCSSDIAIN DPGVLNNGLW ANQTQRMRTY TKVQKCGSVG RCIDVTRYKG  1020
YDELRHDLAR MFGIEGQLED PQRTEWKLVY VDHENDILLV GDDPWEEFVS CVQSIKILSS  1080
SEVQQMSLDG DLGHVPVPNQ ACSGTDNGNA WRGQYDDNSA ASFNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1711535545388Auxin response factor 5
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN12303.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028180693.10.0auxin response factor 19-like
TrEMBLA0A0B2PX490.0A0A0B2PX49_GLYSO; Auxin response factor
STRINGGLYMA09G08350.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49183352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]